TB Genome Annotation Portal

Rv3087 (-)

Amino Acid Sequence

MRRLNGVDALMLYLDGGSAYNHTLKISVLDPSTDPDGWSWPKARQMFEERAHLLPVFRLRYLPTPLGLHHPIWVEDPEFDLDAHVRRVVCPAPGGMAEFC
ALVEQIYAHPLDRDRPLWQTWVVEGLDGGRVALVTLLHHAYSDGVGVLDMLAAFYNDTPDEAPVVAPPWEPPPLPSTRQRLGWALRDLPSRLGKIAPTVR
AVRDRVRIEREFAKDGDRRVPPTFDRSAPPGPFQRGLSRSRRFSCESFPLAEVREVSKTLGVTINDVFLACVAGAVRRYLERCGSPPTDAMVATMPLAVT
PAAERAHPGNYSSVDYVWLRADIADPLERLHATHLAAEATKQHFAQTKDADVGAVVELLPERLISGLARANARTKGRFDTFKNVVVSNVPGPREPRYLGR
WRVDQWFSTGQISHGATLNMTVWSYCDQFNLCVMADAVAVRNTWELLGGFRASHEELLAAARAQATPKEMAT
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv3087/-, gene len: 1418 bp, num TA sites: 14
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASessentialBL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.02)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-0.504)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.68)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.45 (0.78)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv3087/-Rv0260c/nnaR1.62
    Rv3087/-Rv0328/-1.57
    Rv3087/-Rv3058c/-1.48
    Rv3087/-Rv3286c/sigF1.32
    Rv3087/-Rv0081/-1.03


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3087 (-)

    PropertyValueCreatorEvidencePMIDComment
    CitationmymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003sourish10IEP14568148Co-expression (Functional linkage)
    InteractionTranscription Rv3082csourish10IEPCo-expression (Functional linkage)
    A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
    InteractionTranscription Rv3088sourish10NASOperon (Functional linkage)
    A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
    InteractionTranscription Rv3085sourish10IEPCo-expression (Functional linkage)
    A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
    InteractionTranscription Rv3084sourish10IEPCo-expression (Functional linkage)
    A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
    InteractionTranscription Rv3083priyadarshinipriyanka2001IEPCo-expression (Functional linkage)
    A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
    InteractionTranscription Rv3082cpriyadarshinipriyanka2001IEPCo-expression (Functional linkage)
    A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
    InteractionTranscription Rv3082cpriyadarshinipriyanka2001IEPCo-expression (Functional linkage)
    P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
    InteractionTranscription Rv3082cpriyadarshinipriyanka2001IEPCo-expression (Functional linkage)
    A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
    InteractionRegulatedBy Rv3082cyamir.morenoIEPLacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
    A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
    InteractionRegulatedBy Rv3082cyamir.morenoIEPLacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.).
    A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
    NamePutative acyl CoA:diacylglycerol acyltransferasemjacksonIDATriglyceride biosynthesis
    CitationInduction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Daniel, C. Deb et al. J. Bacteriol. 2004mjackson15262939Putative acyl CoA:diacylglycerol acyltransferase (enzymatic)
    OtherTBPWY:Triglyceride biosynthesismjacksonPutative acyl CoA:diacylglycerol acyltransferase (enzymatic)
    J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004

    Comments