Rv3087 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: acyltransferase WS/DGAT/MGAT
- REFSEQ: hypothetical protein
- PATRIC: Wax ester synthase/acyl-CoA:diacylglycerol acyltransferase
- TUBERCULIST: Possible triacylglycerol synthase (diacylglycerol acyltransferase)
- NCBI: Possible triacylglycerol synthase (diacylglycerol acyltransferase)
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Conditional
Start: 3452925
End: 3454343
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0071731 - response to nitric oxide (Uniprot)
- GO:0052562 - negative regulation by symbiont of host immune response (Uniprot)
- GO:0047196 - long-chain-alcohol O-fatty-acyltransferase activity (Uniprot)
- GO:0045017 - glycerolipid biosynthetic process (Uniprot)
- GO:0044119 - growth of symbiont in host cell (Uniprot)
- GO:0019432 - triglyceride biosynthetic process (Uniprot)
- GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0010447 - response to acidic pH (Uniprot)
- GO:0006629 - lipid metabolic process (Uniprot)
- GO:0006071 - glycerol metabolic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0004144 - diacylglycerol O-acyltransferase activity (Uniprot)
- GO:0001666 - response to hypoxia (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- 0.11 HEXACOSANOYL_COA[c] + 0.22 HEXADECANOYL_COA[c] + 0.11 9_HEXADECENOYL_COA[c] + 0.11 OCTADECANOYL_COA[c] + 0.11 9_OCTADECENOY... <Preview truncated at 128 characters>
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv3087:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.835 (from Jeremy Rock's lab)

Amino Acid Sequence

MRRLNGVDALMLYLDGGSAYNHTLKISVLDPSTDPDGWSWPKARQMFEERAHLLPVFRLRYLPTPLGLHHPIWVEDPEFDLDAHVRRVVCPAPGGMAEFC
ALVEQIYAHPLDRDRPLWQTWVVEGLDGGRVALVTLLHHAYSDGVGVLDMLAAFYNDTPDEAPVVAPPWEPPPLPSTRQRLGWALRDLPSRLGKIAPTVR
AVRDRVRIEREFAKDGDRRVPPTFDRSAPPGPFQRGLSRSRRFSCESFPLAEVREVSKTLGVTINDVFLACVAGAVRRYLERCGSPPTDAMVATMPLAVT
PAAERAHPGNYSSVDYVWLRADIADPLERLHATHLAAEATKQHFAQTKDADVGAVVELLPERLISGLARANARTKGRFDTFKNVVVSNVPGPREPRYLGR
WRVDQWFSTGQISHGATLNMTVWSYCDQFNLCVMADAVAVRNTWELLGGFRASHEELLAAARAQATPKEMAT

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 14 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 14 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 14 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 0 non-insertions in a row out of 14 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 14 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.51
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0324 (-) (Direct binding)
- Rv1956 (higA) (Upstream of operon)
- Rv3082c (virS) (Upstream of operon)
- Rv3736 (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. A. Singh, S. Jain et al. FEMS Microbiol. Lett. 2003	sourish10	IEP	14568148	Co-expression (Functional linkage)
Interaction	Transcription Rv3082c	sourish10	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3088	sourish10	NAS		Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3085	sourish10	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3084	sourish10	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3083	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3082c	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3082c	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Transcription Rv3082c	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
Interaction	RegulatedBy Rv3082c	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	RegulatedBy Rv3082c	yamir.moreno	IEP		LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Name	Putative acyl CoA:diacylglycerol acyltransferase	mjackson	IDA		Triglyceride biosynthesis
Citation	Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Daniel, C. Deb et al. J. Bacteriol. 2004	mjackson		15262939	Putative acyl CoA:diacylglycerol acyltransferase (enzymatic)
Other	TBPWY:Triglyceride biosynthesis	mjackson			Putative acyl CoA:diacylglycerol acyltransferase (enzymatic) J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004

TB Genome Annotation Portal