TB Genome Annotation Portal

Rv1934c (fadE17)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: acyl-CoA dehydrogenase fadE17
  • REFSEQ: acyl-CoA dehydrogenase FADE17
  • PATRIC: Butyryl-CoA dehydrogenase (EC 1.3.99.2)
  • TUBERCULIST: Probable acyl-CoA dehydrogenase FadE17
  • NCBI: Probable acyl-CoA dehydrogenase FadE17
  • updated information (H37Rv4):
    • gene name: fadE17
    • function:
    • reference:
• Type: Not Target
• Start: 2184959
• End: 2186188
• Operon:


• Trans-membrane region:
  
• Role: I.A.3 - Fatty acids
• GO terms:
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0050660 - flavin adenine dinucleotide binding (Uniprot)
  • GO:0016627 - oxidoreductase activity, acting on the CH-CH group of donors (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on fadE17:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.148 (from Jeremy Rock's lab)

Amino Acid Sequence

VDVSYPPEAEAFRDRIREFVAEHLPPGWPGPGALPPHEREEFARHWRRALAGAGLVAVSWPTEYGGGGLSPMEQVVLAEEFARAGAPERAENDLLGIDLL
GNTLIALGSEAQKRHFLPRILSGEHRWCQGFSEPEAGSDLASVRTRGVLDGDEWVINGHKIWTSAGTTANWIFLLARTDPSAAKHRGLSFLLVPMDQPGV
VVRPIVNAAGHSSFSEVFLTDARTSAGNVVGRVGDGWSTAMTLLGFERGSHIATAAIDFERDLQRLCELARDRGLHTDPRVRDGLAWCYARVQIMRYRGY
RDLTLALTGRPPGAEAAITKVIWSEYFRRYTDLAVEILGLEALGPRGPGNGGARLVPEAGTPNSPACWMDELLYARAATIYAGSSQIQRNVIGERLLGLP
KEPRPEVLC

Additional Information