TB Genome Annotation Portal

Rv1930c (-)

Amino Acid Sequence

MTQIAFVAYPGVTALDVVGPYEVLRNLPHAQVRFVWLRGRRATSHWLTLPALKAFGAIPVADERIVHQDNIVTSAGVSAGLDLALWLAGQLGGEARAKAI
QLAIEYDPQPPFDSGHMSKASPTTKAAATALLSKDSAKPANLTAATLLAWERALAAVQSRRRKRQPVGAQARRP
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
4 non-insertions in a row out of 5 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 5 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 5 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 6 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 6 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:

      • Not downregulated by other genes.


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1930c (-)

    PropertyValueCreatorEvidencePMIDComment
    CitationMce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. MD. Santangelo, LI. Klepp et al. Microbiology (Reading, Engl.) 2009swatigandhi19IEP19389781Co-expression (Functional Linkage)
    InteractionRegulatory Rv1963cswatigandhi19IEPCo-expression (Functional Linkage)
    MD. Santangelo, LI. Klepp et al. Mce3R, a TetR-type transcriptional repressor, controls the expression of a regulon involved in lipid metabolism in Mycobacterium tuberculosis. Microbiology (Reading, Engl.) 2009
    CitationRevisiting the evolution of Mycobacterium bovis. authors,S. Mostowy,J. Inwald,S. Gordon,C. Martin,R. Warren,K. Kremer,D. Cousins,MA. Behr J. Bacteriol. 2005swatigandhi19IEP16159772Co-expression (Functional Linkage)
    InteractionRegulatory Rv1963cswatigandhi19IEPCo-expression (Functional Linkage)
    authors,S. Mostowy,J. Inwald,S. Gordon,C. Martin,R. Warren,K. Kremer,D. Cousins,MA. Behr Revisiting the evolution of Mycobacterium bovis. J. Bacteriol. 2005
    CitationThe 1.6-A crystal structure of the class of chaperones represented by Escherichia coli Hsp31 reveals a putative catalytic triad. authors,PM. Quigley,K. Korotkov,F. Baneyx,WG. Hol Proc. Natl. Acad. Sci. U.S.A. 2003swatigandhi19IEP12621151Co-expression (Functional Linkage)
    InteractionRegulatory Rv1963cswatigandhi19IEPCo-expression (Functional Linkage)
    authors,PM. Quigley,K. Korotkov,F. Baneyx,WG. Hol The 1.6-A crystal structure of the class of chaperones represented by Escherichia coli Hsp31 reveals a putative catalytic triad. Proc. Natl. Acad. Sci. U.S.A. 2003
    InteractionRegulatedBy Rv1963cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    MP. Santangelo, FC. Blanco et al. Study of the role of Mce3R on the transcription of mce genes of Mycobacterium tuberculosis. BMC Microbiol. 2008

    Comments