TB Genome Annotation Portal

Rv1801 (PPE29)

Amino Acid Sequence

MDFGLLPPEINSGRMYTGPGPGPMLAAATAWDGLAVELHATAAGYASELSALTGAWSGPSSTSMASAAAPYVAWMSATAVHAELAGAQARLAIAAYEAAF
AATVPPPVIAANRAQLMVLIATNIFGQNTPAIMMTEAQYMEMWAQDAAAMYGYAGSSATASRMTAFTEPPQTTNHGQLGAQSSAVAQTAATAAGGNLQSA
FPQLLSAVPRALQGLALPTASQSASATPQWVTDLGNLSTFLGGAVTGPYTFPGVLPPSGVPYLLGIQSVLVTQNGQGVSALLGKIGGKPITGALAPLAEF
ALHTPILGSEGLGGGSVSAGIGRAGLVGKLSVPQGWTVAAPEIPSPAAALQATRLAAAPIAATDGAGALLGGMALSGLAGRAAAGSTGHPIGSAAAPAVG
AAAAAVEDLATEANIFVIPAMDD
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
5 non-insertions in a row out of 25 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
4 non-insertions in a row out of 25 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
4 non-insertions in a row out of 25 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 26 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 26 sites
No-Data 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Too-Short C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: -1
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:

      • Not downregulated by other genes.


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1801 (PPE29)

    PropertyValueCreatorEvidencePMIDComment
    CitationIdentifying cognate binding pairs among a large set of paralogs: the case of PE/PPE proteins of Mycobacterium tuberculosis. authors,R. Riley,M. Pellegrini,D. Eisenberg PLoS Comput. Biol. 2008razeeth.newNAS18787688None
    InteractionPhysicalInteraction Rv0754razeeth.newNAS
    authors,R. Riley,M. Pellegrini,D. Eisenberg Identifying cognate binding pairs among a large set of paralogs: the case of PE/PPE proteins of Mycobacterium tuberculosis. PLoS Comput. Biol. 2008
    InteractionPhysicalInteraction Rv0160crazeeth.newNAS
    authors,R. Riley,M. Pellegrini,D. Eisenberg Identifying cognate binding pairs among a large set of paralogs: the case of PE/PPE proteins of Mycobacterium tuberculosis. PLoS Comput. Biol. 2008
    CitationMycobacterium tuberculosis invasion and traversal across an in vitro human blood-brain barrier as a pathogenic mechanism for central nervous system tuberculosis. SK. Jain, M. Paul-Satyaseela et al. J. Infect. Dis. 2006jlew16586367Mutant is deficient in ability to invade the BBB.. Microarrays found 33 M. tuberculosis genes highly up-regulated during the early stages of invasion of the BBB by M. tuberculosis. M. tuberculosis isogenic transposon mutants for the up-regulated genes Rv0980c, Rv0987, Rv0989c, and Rv1801 were found to be deficient in their ability to invade the BBB model.

    Comments