TB Genome Annotation Portal

Rv0763c (-)

Amino Acid Sequence

MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQALSIRETGE
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)0.73 (0.06)1.25 (0.33)
codons under selection
omega plots
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"


ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0763c/-, gene len: 206 bp, num TA sites: 3
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBioUncertain7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathtoo shortM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathtoo shortM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-5.24)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=-1.207)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=1.96)YM rich vs minimal mediumresampling

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv0763c (-)

    PropertyValueCreatorEvidencePMIDComment
    CitationA novel sterol 14alpha-demethylase/ferredoxin fusion protein (MCCYP51FX) from Methylococcus capsulatus represents a new class of the cytochrome P450 superfamily. CJ. Jackson, DC. Lamb et al. J. Biol. Chem. 2002amit.srcpIDA12235134Structural Analysis
    InteractionPhysicalInteraction Rv0764camit.srcpIDAStructural Analysis
    CJ. Jackson, DC. Lamb et al. A novel sterol 14alpha-demethylase/ferredoxin fusion protein (MCCYP51FX) from Methylococcus capsulatus represents a new class of the cytochrome P450 superfamily. J. Biol. Chem. 2002
    CitationBiophysical characterization of the sterol demethylase P450 from Mycobacterium tuberculosis, its cognate ferredoxin, and their interactions. KJ. McLean, AJ. Warman et al. Biochemistry 2006amit.srcpIDA16819841Structural Analysis
    InteractionPhysicalInteraction Rv0764camit.srcpIDAStructural Analysis
    KJ. McLean, AJ. Warman et al. Biophysical characterization of the sterol demethylase P450 from Mycobacterium tuberculosis, its cognate ferredoxin, and their interactions. Biochemistry 2006
    CitationMycobacterial cytochrome p450 125 (cyp125) catalyzes the terminal hydroxylation of c27 steroids. JK. Capyk, R. Kalscheuer et al. J. Biol. Chem. 2009amit.srcpIDA19846551Structural Analysis
    InteractionPhysicalInteraction Rv0764camit.srcpIDAStructural Analysis
    JK. Capyk, R. Kalscheuer et al. Mycobacterial cytochrome p450 125 (cyp125) catalyzes the terminal hydroxylation of c27 steroids. J. Biol. Chem. 2009
    CitationCharacterization and catalytic properties of the sterol 14alpha-demethylase from Mycobacterium tuberculosis. A. Bellamine, AT. Mangla et al. Proc. Natl. Acad. Sci. U.S.A. 1999amit.srcpIDA10430874Structural Analysis
    InteractionPhysicalInteraction Rv0764camit.srcpIDAStructural Analysis
    A. Bellamine, AT. Mangla et al. Characterization and catalytic properties of the sterol 14alpha-demethylase from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 1999
    CitationStructure, function and drug targeting in Mycobacterium tuberculosis cytochrome P450 systems. authors,KJ. McLean,AJ. Dunford,R. Neeli,MD. Driscoll,AW. Munro Arch. Biochem. Biophys. 2007amit.srcpIDA17482138Structural Analysis
    InteractionPhysicalInteraction Rv0764camit.srcpIDAStructural Analysis
    authors,KJ. McLean,AJ. Dunford,R. Neeli,MD. Driscoll,AW. Munro Structure, function and drug targeting in Mycobacterium tuberculosis cytochrome P450 systems. Arch. Biochem. Biophys. 2007
    CitationBiophysical characterization of the sterol demethylase P450 from Mycobacterium tuberculosis, its cognate ferredoxin, and their interactions. KJ. McLean, AJ. Warman et al. Biochemistry 2006amit.srcpIDA16819841Spectrophotometric
    InteractionPhysicalInteraction Rv0764camit.srcpIDASpectrophotometric
    KJ. McLean, AJ. Warman et al. Biophysical characterization of the sterol demethylase P450 from Mycobacterium tuberculosis, its cognate ferredoxin, and their interactions. Biochemistry 2006
    CitationMycobacterial cytochrome p450 125 (cyp125) catalyzes the terminal hydroxylation of c27 steroids. JK. Capyk, R. Kalscheuer et al. J. Biol. Chem. 2009amit.srcpIDA19846551Spectrophotometric
    InteractionPhysicalInteraction Rv0764camit.srcpIDASpectrophotometric
    JK. Capyk, R. Kalscheuer et al. Mycobacterial cytochrome p450 125 (cyp125) catalyzes the terminal hydroxylation of c27 steroids. J. Biol. Chem. 2009
    CitationCharacterization and catalytic properties of the sterol 14alpha-demethylase from Mycobacterium tuberculosis. A. Bellamine, AT. Mangla et al. Proc. Natl. Acad. Sci. U.S.A. 1999amit.srcpIDA10430874Spectrophotometric
    InteractionPhysicalInteraction Rv0764camit.srcpIDASpectrophotometric
    A. Bellamine, AT. Mangla et al. Characterization and catalytic properties of the sterol 14alpha-demethylase from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 1999
    CitationStructure, function and drug targeting in Mycobacterium tuberculosis cytochrome P450 systems. authors,KJ. McLean,AJ. Dunford,R. Neeli,MD. Driscoll,AW. Munro Arch. Biochem. Biophys. 2007amit.srcpIDA17482138Spectrophotometric
    InteractionPhysicalInteraction Rv0764camit.srcpIDASpectrophotometric
    authors,KJ. McLean,AJ. Dunford,R. Neeli,MD. Driscoll,AW. Munro Structure, function and drug targeting in Mycobacterium tuberculosis cytochrome P450 systems. Arch. Biochem. Biophys. 2007
    CitationCYP121, CYP51 and associated redox systems in Mycobacterium tuberculosis: towards deconvoluting enzymology of P450 systems in a human pathogen. KJ. McLean, AJ. Dunford et al. Biochem. Soc. Trans. 2006amit.srcpIDA17073780Structural Analysis
    InteractionPhysicalInteraction Rv0764camit.srcpIDAStructural Analysis
    KJ. McLean, AJ. Dunford et al. CYP121, CYP51 and associated redox systems in Mycobacterium tuberculosis: towards deconvoluting enzymology of P450 systems in a human pathogen. Biochem. Soc. Trans. 2006
    CitationCYP121, CYP51 and associated redox systems in Mycobacterium tuberculosis: towards deconvoluting enzymology of P450 systems in a human pathogen. KJ. McLean, AJ. Dunford et al. Biochem. Soc. Trans. 2006amit.srcpIDA17073780Spectrophotometric
    InteractionPhysicalInteraction Rv0764camit.srcpIDASpectrophotometric
    KJ. McLean, AJ. Dunford et al. CYP121, CYP51 and associated redox systems in Mycobacterium tuberculosis: towards deconvoluting enzymology of P450 systems in a human pathogen. Biochem. Soc. Trans. 2006
    CitationA novel sterol 14alpha-demethylase/ferredoxin fusion protein (MCCYP51FX) from Methylococcus capsulatus represents a new class of the cytochrome P450 superfamily. CJ. Jackson, DC. Lamb et al. J. Biol. Chem. 2002amit.srcpIDA12235134Spectrophotometric
    InteractionPhysicalInteraction Rv0764camit.srcpIDASpectrophotometric
    CJ. Jackson, DC. Lamb et al. A novel sterol 14alpha-demethylase/ferredoxin fusion protein (MCCYP51FX) from Methylococcus capsulatus represents a new class of the cytochrome P450 superfamily. J. Biol. Chem. 2002

    Comments