TB Genome Annotation Portal

Rv0763c (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ferredoxin
  • REFSEQ: ferredoxin
  • PATRIC: Ferredoxin
  • TUBERCULIST: Possible ferredoxin
  • NCBI: Possible ferredoxin
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 856473
• End: 856679
• Operon:


• Trans-membrane region:
  
• Role: IV.F - Cytochrome P450 enzymes
• GO terms:
  • No terms assigned.
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6MCW	42%	Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath)	Crystal structure of the P450 domain of the CYP51-ferredoxin fusion protein from Methylococcus capsulatus, complex with the detergent Anapoe-X-114

• Links to additional information on Rv0763c:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.036 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MGYRVEADRDLCQGHAMCELEAPEYFRVPKRGQVEILDPEPPEEARGVIKHAVWACPTQALSIRETGE

Additional Information