TB Genome Annotation Portal

Rv0098 (fcoT)

Amino Acid Sequence

MSHTDLTPCTRVLASSGTVPIAEELLARVLEPYSCKGCRYLIDAQYSATEDSVLAYGNFTIGESAYIRSTGHFNAVELILCFNQLAYSAFAPAVLNEEIR
VLRGWSIDDYCQHQLSSMLIRKASSRFRKPLNPQKFSARLLCRDLQVIERTWRYLKVPCVIEFWDENGGAASGEIELAALNIP
(Nucleotide sequence available on KEGG)

Additional Information
















Analysis of Positive Selection in Clinical Isolates
*new*






Moldova (2,057)global set (5,195)

under significant positive selection?NONO

omega peak height (95%CI lower bound)0.81 (0.08)0.53 (0.23)

codons under selection

omega plots

genetic variants*linklink

statistics at each codonlinklink



* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"











    ESSENTIALITY 

    







    



MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb


TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv0098/fcoT,
gene len: 551 bp, num TA sites: 12



conditiondatasetcallmediummethodnotes

in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined

in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2

in-vivo (mice)Sassetti 2003 PNASessentialBL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)

in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05

in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05

differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.96)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol

in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)

in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)

differentially essential in miceSmith 2022 eLifeNO (LFC=-1.391)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice

in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM

in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)

differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.54)YM rich vs minimal mediumresampling







    












 





    TnSeq Data    No data currently available.

    




    



        
  •  No TnSeq data currently available for this Target.



















    RNASeq Data   No data currently available.

    





    



        
  •  No RNA-Seq data currently available for this Target.




















    Metabolomic Profiles    No data currently available.

    





    




        
  •  No Metabolomic data currently available for this Target.




















    Proteomic Data   No data currently available. 

    






    



        
  •  No Proteomic data currently available for this Target.


















 





    Regulatory Relationships from Systems Biology 

    




    






                
  • BioCyc


    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)
    

    NOTE: 
    Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.




    Interactions based on ChIPSeq data
    

    
    

    
    
    

    • 






    Interactions based on ChIPSeq data (Minch et al. 2014)
    




    Interactions based on TFOE data (Rustad et al. 2014)
    














    

    






    


    


    


    TBCAP
    
Tubculosis Community Annotation Project (    Slayden et al., 2013)
    
Rv0098 (fcoT)

    

    PropertyValueCreatorEvidencePMIDComment
    
InteractionTranscription Rv0102gaurisd10IEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    
InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    
InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    
InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    
InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    
InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    
InteractionTranscription Rv0102ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    
CitationMycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. S. Raman, X. Puyang et al. J. Bacteriol. 2006ashwinigbhatIEP17028284Microarray Analysis
    
InteractionRegulatory Rv3911ashwinigbhatIEPMicroarray Analysis
    S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
    
CitationIdentification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. F. Wang, R. Langley et al. Chem. Biol. 2007ashwinigbhatIEP17524985Microarray Analysis
    
InteractionRegulatory Rv3911ashwinigbhatIEPMicroarray Analysis
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
InteractionTranscription Rv0097ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
InteractionTranscription Rv0102ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
CitationThe structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. King-Scott, E. Nowak et al. J. Biol. Chem. 2007ashwinigbhatIEP17942407Coexpression
    
InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    
InteractionTranscription Rv0097ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    
InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
InteractionTranscription Rv0097ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
InteractionTranscription Rv0099ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
InteractionTranscription Rv0100ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
InteractionTranscription Rv0101ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
InteractionTranscription Rv0102ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
CitationIdentification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. F. Wang, R. Langley et al. Chem. Biol. 2007ashwinigbhatIEP17524985Coexpression
    
InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
CitationThe senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. T. Parish, DA. Smith et al. Microbiology (Reading, Engl.) 2003ashwinigbhatIEP12777483Microarray Analysis
    
InteractionRegulatory Rv0491ashwinigbhatIEPMicroarray Analysis
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
CitationIdentification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. F. Wang, R. Langley et al. Chem. Biol. 2007ashwinigbhatIEP17524985Microarray Analysis
    
InteractionRegulatory Rv0491ashwinigbhatIEPMicroarray Analysis
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
CitationThe senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. T. Parish, DA. Smith et al. Microbiology (Reading, Engl.) 2003ashwinigbhatIEP12777483Coexpression
    
InteractionTranscription Rv0097ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    
InteractionTranscription Rv0097ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
InteractionTranscription Rv0097ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    J. King-Scott, E. Nowak et al. The structure of a full-length response regulator from Mycobacterium tuberculosis in a stabilized three-dimensional domain-swapped, activated state. J. Biol. Chem. 2007
    
InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    F. Wang, R. Langley et al. Identification of a type III thioesterase reveals the function of an operon crucial for Mtb virulence. Chem. Biol. 2007
    
InteractionTranscription Rv0096ashwinigbhatIEPCoexpression
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
InteractionRegulatedBy Rv3911yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
    
InteractionRegulatedBy Rv0491yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type  and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    
SymbolfcoTmjacksonISSClaisen-type condensation
    
NamePROBABLE FATTY ACYL CoA THIOESTERASE TYPE III, probably involved together with the enzymes encoded by the genes of the operon in the biosynthesis of a still unknown lipopeptidemjacksonISSClaisen-type condensation
    
SymbolfcoTmjacksonIDAClaisen-type condensation
    
NamePROBABLE FATTY ACYL CoA THIOESTERASE TYPE III, probably involved together with the enzymes encoded by the genes of the operon in the biosynthesis of a still unknown lipopeptidemjacksonIDAClaisen-type condensation
    
CitationPathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. K. Takayama, C. Wang et al. Clin. Microbiol. Rev. 2005jjmcfadden15653820Inferred from direct assay
    
TermEC:2.1.1.-  Transferases.  Transferring one-carbon groups.   Methyltransferases. - NRjjmcfaddenNRInferred from direct assay
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    
TermEC:2.3.1.41 Beta-ketoacyl-acyl-carrier-protein synthase I. - NRjjmcfaddenNRInferred from direct assay
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    
TermEC:4.2.1.61 3-hydroxypalmitoyl-[acyl-carrier-protein] dehydratase. - NRjjmcfaddenNRInferred from direct assay
    K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
    

    


    Comments