TB Genome Annotation Portal

Rv3871 (eccCb1)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ESX-1 secretion system protein EccCb1
  • REFSEQ: hypothetical protein
  • PATRIC: FtsK/SpoIIIE family protein Rv3871 component of ESX-1 secretion system
  • TUBERCULIST: ESX conserved component EccCb1. ESX-1 type VII secretion system protein.
  • NCBI: ESX conserved component EccCb1 ESX-1 type VII secretion system protein
  • updated information (H37Rv4):
    • gene name: eccCb1
    • function:
    • reference:
• Type: Conditional
• Start: 4348827
• End: 4350602
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0044315 - protein secretion by the type VII secretion system (Uniprot)
  • GO:0044117 - growth of symbiont in host (Uniprot)
  • GO:0042783 - active evasion of host immune response (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6JD4	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	ATPase
  6J19	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	ATPase
  4N1A	38%	Thermomonospora curvata	Thermomonospora curvata EccC (ATPases 2 and 3) in complex with a signal sequence peptide
  4NH0	38%	Thermomonospora curvata	Cytoplasmic domain of the Thermomonospora curvata Type VII Secretion ATPase EccC

• Links to additional information on eccCb1:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.826 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MTAEPEVRTLREVVLDQLGTAESRAYKMWLPPLTNPVPLNELIARDRRQPLRFALGIMDEPRRHLQDVWGVDVSGAGGNIGIGGAPQTGKSTLLQTMVMS
AAATHSPRNVQFYCIDLGGGGLIYLENLPHVGGVANRSEPDKVNRVVAEMQAVMRQRETTFKEHRVGSIGMYRQLRDDPSQPVASDPYGDVFLIIDGWPG
FVGEFPDLEGQVQDLAAQGLAFGVHVIISTPRWTELKSRVRDYLGTKIEFRLGDVNETQIDRITREIPANRPGRAVSMEKHHLMIGVPRFDGVHSADNLV
EAITAGVTQIASQHTEQAPPVRVLPERIHLHELDPNPPGPESDYRTRWEIPIGLRETDLTPAHCHMHTNPHLLIFGAAKSGKTTIAHAIARAICARNSPQ
QVRFMLADYRSGLLDAVPDTHLLGAGAINRNSASLDEAVQALAVNLKKRLPPTDLTTAQLRSRSWWSGFDVVLLVDDWHMIVGAAGGMPPMAPLAPLLPA
AADIGLHIIVTCQMSQAYKATMDKFVGAAFGSGAPTMFLSGEKQEFPSSEFKVKRRPPGQAFLVSPDGKEVIQAPYIEPPEEVFAAPPSAG

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.55 (0.29)	1.22 (0.61)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link