TB Genome Annotation Portal

Rv3681c (whiB4)

Amino Acid Sequence

VSGTRPAARRTNLTAAQNVVRSVDAEERIAWVSKALCRTTDPDELFVRGAAQRKAAVICRHCPVMQECAADALDNKVEFGVWGGMTERQRRALLKQHPEV
VSWSDYLEKRKRRTGTAG
(Nucleotide sequence available on KEGG)

Additional Information


















    ESSENTIALITY 

    







    



MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb


TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*



        

        
 Classification Condition Strain Method Reference Notes 


            

                Non-Essential
                Sodium Oleate
                H37RvMA

                    Gumbel



                    Subhalaxmi Nambi


                Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 7 sites		
            



            

                Non-Essential
                Lignoceric Acid
                H37RvMA

                    Gumbel



                    Subhalaxmi Nambi


                Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 7 sites		
            



            

                Non-Essential
                Phosphatidylcholine
                H37RvMA

                    Gumbel



                    Subhalaxmi Nambi


                Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 7 sites		
            



            

                Non-Essential
                minimal media + 0.1% glycerol
                H37RvMA

                    Gumbel



                    Griffin et al. (2011)


                Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 8 sites		
            



            

                Non-Essential
                minimal media + 0.01% cholesterol
                H37RvMA

                    Gumbel



                    Griffin et al. (2011)


                Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 8 sites		
            



            

                Non-Essential
                7H10-glycerol
                H37RvMA

                    TraSH



                    Sassetti et al. (2003a)


                 
            



            

                Non-Essential
                C57BL/6J mice (8 weeks)
                H37RvMA

                    TraSH



                    Sassetti et al. (2003b)


                Hybridization Ratio: 1.06
            



            

                Non-Essential
                7H09/7H10 + rich media
                H37RvMA

                    MotifHMM



                    DeJesus et al. (2017)


                Fully saturated (14 reps).
            



        



    












 





    TnSeq Data    No data currently available.

    




    



        
  •  No TnSeq data currently available for this Target.



















    RNASeq Data   No data currently available.

    





    



        
  •  No RNA-Seq data currently available for this Target.




















    Metabolomic Profiles    No data currently available.

    





    




        
  •  No Metabolomic data currently available for this Target.




















    Proteomic Data   No data currently available. 

    






    



        
  •  No Proteomic data currently available for this Target.


















 





    Regulatory Relationships from Systems Biology 

    




    






                
  • BioCyc


    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)
    

    NOTE: 
    Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.




    Interactions based on ChIPSeq data
    

    
    

    
    
    

    • 






    Interactions based on ChIPSeq data (Minch et al. 2014)
    




    Interactions based on TFOE data (Rustad et al. 2014)
    














    

    






    


    


    


    TBCAP
    
Tubculosis Community Annotation Project (    Slayden et al., 2013)
    
Rv3681c (whiB4)

    

    PropertyValueCreatorEvidencePMIDComment
    
CitationDissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009yamir.morenoIDA19228590One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    
InteractionRegulates Rv2031cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    
CitationDissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009yamir.morenoIDA19228590One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    
InteractionRegulates Rv3249cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    
CitationDissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009yamir.morenoIDA19228590One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    
InteractionRegulates Rv3250cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    
CitationDissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009yamir.morenoIDA19228590One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    
InteractionRegulates Rv3251cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    
CitationDissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009yamir.morenoIDA19228590One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    
InteractionRegulates Rv3252cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    

    


    Comments