Rv3631 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: transferase
- REFSEQ: transferase
- PATRIC: Dolichol-phosphate mannosyltransferase (EC 2.4.1.83) in lipid-linked oligosaccharide synthesis cluster
- TUBERCULIST: Possible transferase (possibly glycosyltransferase)
- NCBI: Possible transferase (possibly glycosyltransferase)
- updated information (H37Rv4):
  - gene name: ppgS
  - function: source of galactosamine for AG; polyprenyl-phospho-N-acetylgalactosaminyl synthase
  - reference: Skovierova (2010) PMID 21030587
Type: Conditional
Start: 4070514
End: 4071239
Operon:

Trans-membrane region:
Role: IV.H - Miscellaneous transferases
GO terms:
- GO:0019375 - galactolipid biosynthetic process (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv3631:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -0.287 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MASKMDTETHYSDVWVVIPAFNEAAVIGKVVTDVRSVFDHVVCVDDGSTDGTGDIARRSGAHLVRHPINLGQGAAIQTGIEYARKQPGAQVFATFDGDGQ
HRVKDVAAMVDRLGAGDVDVVIGTRFGRPVGKASASRPPLMKRIVLQTGARLSRRGRRLGLTDTNNGLRVFNKTVADGLNITMSGMSHATEFIMLIAENH
WRVAEEPVEVLYTEYSKSKGQPLLNGVNIIFDGFLRGRMPR

(Nucleotide sequence available on KEGG)

Additional Information

ppgS - polyprenyl-phospho-N-acetylgalactosaminyl synthase.
source of galactosamine for arabinogalactan synthesis.
Skovierova et al (2010) PMID 21030587

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 3 non-insertions in a row out of 6 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 6 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 6 sites
Uncertain	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.165700; 2 non-insertions in a row out of 6 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.349200; 3 non-insertions in a row out of 6 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-) (Direct binding)
- Rv1990c (-) (Direct binding)
- Rv2250c (-) (Direct binding)
- Rv3574 (kstR) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Symbol	ppgS	mjackson	IMP		Decaprenyl phosphogalactosamine synthesis
Name	polyprenyl-phospho-N-acetylgalactosaminyl synthase	mjackson	IMP		Decaprenyl phosphogalactosamine synthesis
Symbol	ppgS	mjackson	IDA		Decaprenyl phosphogalactosamine synthesis
Name	polyprenyl-phospho-N-acetylgalactosaminyl synthase	mjackson	IDA		Decaprenyl phosphogalactosamine synthesis
Symbol	ppgS	mmcneil			Polyprenyl-phospho-N-acetylgalactosaminyl synthase (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,H. Skovierov,G. Larrouy-Maumus,H. Pham,M. Belanov,N. Barilone,A. Dasgupta,K. Mikusov,B. Gicquel,M. Gilleron,PJ. Brennan,G. Puzo,J. Nigou,M. Jackson Biosynthetic origin of the galactosamine substituent of Arabinogalactan in Mycobacterium tuberculosis. J. Biol. Chem. 2010
Citation	Biosynthetic origin of the galactosamine substituent of Arabinogalactan in Mycobacterium tuberculosis. authors,H. Skovierov,G. Larrouy-Maumus,H. Pham,M. Belanov,N. Barilone,A. Dasgupta,K. Mikusov,B. Gicquel,M. Gilleron,PJ. Brennan,G. Puzo,J. Nigou,M. Jackson J. Biol. Chem. 2010	mmcneil		21030587	Polyprenyl-phospho-N-acetylgalactosaminyl synthase (phenotypic [mycobacterial recombinant strains]; enzymatic)
Term	GO:0016757 transferase activity, transferring glycosyl groups - NR	mmcneil	NR		Polyprenyl-phospho-N-acetylgalactosaminyl synthase (phenotypic [mycobacterial recombinant strains]; enzymatic) authors,H. Skovierov,G. Larrouy-Maumus,H. Pham,M. Belanov,N. Barilone,A. Dasgupta,K. Mikusov,B. Gicquel,M. Gilleron,PJ. Brennan,G. Puzo,J. Nigou,M. Jackson Biosynthetic origin of the galactosamine substituent of Arabinogalactan in Mycobacterium tuberculosis. J. Biol. Chem. 2010

TB Genome Annotation Portal