Rv3610c (ftsH)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: ATP-dependent zinc metalloprotease FtsH
REFSEQ: membrane-bound protease FTSH (cell division protein)
PATRIC: Cell division protein FtsH (EC 3.4.24.-)
TUBERCULIST: Membrane-bound protease FtsH (cell division protein)
NCBI: Membrane-bound protease FtsH (cell division protein)
updated information (H37Rv4):
gene name: ftsH
function:
reference:
Coordinates in H37Rv: 4050601 - 4052883
Gene length: 2283 bp (with stop codon), 760 aa (without stop codon)
Operon:
Trans-membrane region:
Role: III.C - Cell division
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 1IY1 70% Thermus thermophilus Crystal structure of the FtsH ATPase domain with ADP from Thermus thermophilus 1IY0 70% Thermus thermophilus Crystal structure of the FtsH ATPase domain with AMP-PNP from Thermus thermophilus 1IXZ 70% Thermus thermophilus Crystal structure of the FtsH ATPase domain from Thermus thermophilus 1LV7 68% Escherichia coli Crystal Structure of the AAA domain of FtsH 1IY2 68% Thermus thermophilus Crystal structure of the FtsH ATPase domain from Thermus thermophilus 2R65 62% Helicobacter pylori Crystal structure of Helicobacter pylori ATP dependent protease, FtsH ADP complex 2R62 62% Helicobacter pylori Crystal structure of Helicobacter pylori ATP dependent protease, FtsH 2CEA 57% Thermotoga maritima CELL DIVISION PROTEIN FTSH 2CE7 57% Thermotoga maritima EDTA treated 8VWC 57% Thermotoga maritima CryoEM Structure of a FtsH Helical Assembly in the Aged State
Links to additional information on ftsH:
Amino Acid Sequence
MNRKNVTRTITAIAVVVLLGWSFFYFSDDTRGYKPVDTSVAITQINGDNVKSAQIDDREQQLRLILKKGNNETDGSEKVITKYPTGYAVDLFNALSAKNA
KVSTVVNQGSILGELLVYVLPLLLLVGLFVMFSRMQGGARMGFGFGKSRAKQLSKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKGVL
LYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRA
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSKGKPMAADADLDGLAKRTVGMTGADLANVINEAALLTARENGTVITGPALEEAV
DRVIGGPRRKGRIISEQEKKITAYHEGGHTLAAWAMPDIEPIYKVTILARGRTGGHAVAVPEEDKGLRTRSEMIAQLVFAMGGRAAEELVFREPTTGAVS
DIEQATKIARSMVTEFGMSSKLGAVKYGSEHGDPFLGRTMGTQPDYSHEVAREIDEEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRPELES
IFADVEKRPRLTMFDDFGGRIPSDKPPIKTPGELAIERGEPWPQPVPEPAFKAAIAQATQAAEAARSDAGQTGHGANGSPAGTHRSGDRQYGSTQPDYGA
PAGWHAPGWPPRSSHRPSYSGEPAPTYPGQPYPTGQADPGSDESSAEQDDEVSRTKPAHG
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv3610c/ftsH,
gene len: 2282 bp, num TA sites: 34
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS no data BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath uncertain M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-0.15) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.539) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys YES (LFC=-2.62) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv3610c: 0.388870068
lineage-specific pN/pS in L1: 0.301001492
lineage-specific pN/pS in L2: 0.395064458
lineage-specific pN/pS in L3: 0.568966235
lineage-specific pN/pS in L4: 0.382814397
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.15 (0.55)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Interaction Translation Rv0732 shahanup86 IDA Affinity purification (Physical interaction)authors,R. Srinivasan,H. Rajeswari,P. Ajitkumar Analysis of degradation of bacterial cell division protein FtsZ by the ATP-dependent zinc-metalloprotease FtsH in vitro. Microbiol. Res. 2008
Interaction Translation Rv2150c shahanup86 IDA Affinity purification (Physical interaction)authors,R. Srinivasan,H. Rajeswari,P. Ajitkumar Analysis of degradation of bacterial cell division protein FtsZ by the ATP-dependent zinc-metalloprotease FtsH in vitro. Microbiol. Res. 2008
Citation Bacterial cell division protein FtsZ is a specific substrate for the AAA family protease FtsH. authors,G. Anilkumar,R. Srinivasan,SP. Anand,P. Ajitkumar Microbiology (Reading, Engl.) 2001 shahanup86 IDA 11238958 Affinity purification (Physical interaction)
Interaction Translation Rv0732 shahanup86 IDA Affinity purification (Physical interaction)authors,G. Anilkumar,R. Srinivasan,SP. Anand,P. Ajitkumar Bacterial cell division protein FtsZ is a specific substrate for the AAA family protease FtsH. Microbiology (Reading, Engl.) 2001
Interaction Translation Rv2150c shahanup86 IDA Affinity purification (Physical interaction)authors,G. Anilkumar,R. Srinivasan,SP. Anand,P. Ajitkumar Bacterial cell division protein FtsZ is a specific substrate for the AAA family protease FtsH. Microbiology (Reading, Engl.) 2001
Citation Genomic organization and in vivo characterization of proteolytic activity of FtsH of Mycobacterium smegmatis SN2. G. Anilkumar, R. Srinivasan et al. Microbiology (Reading, Engl.) 2004 shahanup86 IDA 15289559 Affinity purification (Physical interaction)
Interaction Translation Rv0732 shahanup86 IDA Affinity purification (Physical interaction)G. Anilkumar, R. Srinivasan et al. Genomic organization and in vivo characterization of proteolytic activity of FtsH of Mycobacterium smegmatis SN2. Microbiology (Reading, Engl.) 2004
Interaction Translation Rv2150c shahanup86 IDA Affinity purification (Physical interaction)G. Anilkumar, R. Srinivasan et al. Genomic organization and in vivo characterization of proteolytic activity of FtsH of Mycobacterium smegmatis SN2. Microbiology (Reading, Engl.) 2004
Interaction Translation Rv2150c shahanup86 IDA Affinity purification (Physical interaction)authors,H. Zheng,L. Lu,B. Wang,S. Pu,X. Zhang,G. Zhu,W. Shi,L. Zhang,H. Wang,S. Wang,G. Zhao,Y. Zhang Genetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv. PLoS ONE 2008
Citation Degradation of sigma 32, the heat shock regulator in Escherichia coli, is governed by HflB. authors,C. Herman,D. Thvenet,R. D'Ari,P. Bouloc Proc. Natl. Acad. Sci. U.S.A. 1995 shahanup86 IDA 7724592 Affinity purification (Physical interaction)
Interaction Translation Rv0732 shahanup86 IDA Affinity purification (Physical interaction)authors,C. Herman,D. Thvenet,R. D'Ari,P. Bouloc Degradation of sigma 32, the heat shock regulator in Escherichia coli, is governed by HflB. Proc. Natl. Acad. Sci. U.S.A. 1995
Interaction Translation Rv2150c shahanup86 IDA Affinity purification (Physical interaction)authors,C. Herman,D. Thvenet,R. D'Ari,P. Bouloc Degradation of sigma 32, the heat shock regulator in Escherichia coli, is governed by HflB. Proc. Natl. Acad. Sci. U.S.A. 1995
Citation Cloning and expression of the gene coding for FtsH protease from Mycobacterium tuberculosis H37Rv. G. Anilkumar, MM. Chauhan et al. Gene 1998 shahanup86 IDA 9729123 Affinity purification (Physical interaction)
Interaction Translation Rv0732 shahanup86 IDA Affinity purification (Physical interaction)G. Anilkumar, MM. Chauhan et al. Cloning and expression of the gene coding for FtsH protease from Mycobacterium tuberculosis H37Rv. Gene 1998
Interaction Translation Rv2150c shahanup86 IDA Affinity purification (Physical interaction)G. Anilkumar, MM. Chauhan et al. Cloning and expression of the gene coding for FtsH protease from Mycobacterium tuberculosis H37Rv. Gene 1998
Citation Analysis of degradation of bacterial cell division protein FtsZ by the ATP-dependent zinc-metalloprotease FtsH in vitro. authors,R. Srinivasan,H. Rajeswari,P. Ajitkumar Microbiol. Res. 2008 shahanup86 IDA 16638632 Affinity purification (Physical interaction)
Citation Functional characterization of AAA family FtsH protease of Mycobacterium tuberculosis. R. Srinivasan, G. Anilkumar et al. FEMS Microbiol. Lett. 2006 shahanup86 IDA 16684108 Affinity purification (Physical interaction)
Interaction Translation Rv0732 shahanup86 IDA Affinity purification (Physical interaction)R. Srinivasan, G. Anilkumar et al. Functional characterization of AAA family FtsH protease of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2006
Interaction Translation Rv2150c shahanup86 IDA Affinity purification (Physical interaction)R. Srinivasan, G. Anilkumar et al. Functional characterization of AAA family FtsH protease of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2006
Citation Genetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv. authors,H. Zheng,L. Lu,B. Wang,S. Pu,X. Zhang,G. Zhu,W. Shi,L. Zhang,H. Wang,S. Wang,G. Zhao,Y. Zhang PLoS ONE 2008 shahanup86 IDA 18584054 Affinity purification (Physical interaction)
Interaction Translation Rv0732 shahanup86 IDA Affinity purification (Physical interaction)authors,H. Zheng,L. Lu,B. Wang,S. Pu,X. Zhang,G. Zhu,W. Shi,L. Zhang,H. Wang,S. Wang,G. Zhao,Y. Zhang Genetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv. PLoS ONE 2008
Name Quality control membrane protease mjackson ISS Cell division
Name Quality control membrane protease mjackson IMP Cell division