TB Genome Annotation Portal

Rv3610c (ftsH)

Amino Acid Sequence

MNRKNVTRTITAIAVVVLLGWSFFYFSDDTRGYKPVDTSVAITQINGDNVKSAQIDDREQQLRLILKKGNNETDGSEKVITKYPTGYAVDLFNALSAKNA
KVSTVVNQGSILGELLVYVLPLLLLVGLFVMFSRMQGGARMGFGFGKSRAKQLSKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKGVL
LYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRA
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSKGKPMAADADLDGLAKRTVGMTGADLANVINEAALLTARENGTVITGPALEEAV
DRVIGGPRRKGRIISEQEKKITAYHEGGHTLAAWAMPDIEPIYKVTILARGRTGGHAVAVPEEDKGLRTRSEMIAQLVFAMGGRAAEELVFREPTTGAVS
DIEQATKIARSMVTEFGMSSKLGAVKYGSEHGDPFLGRTMGTQPDYSHEVAREIDEEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRPELES
IFADVEKRPRLTMFDDFGGRIPSDKPPIKTPGELAIERGEPWPQPVPEPAFKAAIAQATQAAEAARSDAGQTGHGANGSPAGTHRSGDRQYGSTQPDYGA
PAGWHAPGWPPRSSHRPSYSGEPAPTYPGQPYPTGQADPGSDESSAEQDDEVSRTKPAHG
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv3610c/ftsH, gene len: 2282 bp, num TA sites: 34
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathuncertainM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.15)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.539)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysYES (LFC=-2.62)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.86 (0.37)1.24 (0.51)
codons under selection
omega plotsomega plot across ORF for Moldova isolatesomega plot across ORF for CRyPTIC isolates
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    RNA processing and modification
    Energy production and conversion
    Chromatin structure and dynamics
    Amino acid transport and metabolism
    Cell cycle control, cell division, chromosome partitioning
    Carbohydrate transport and metabolism
    Nucleotide transport and metabolism
    Lipid transport and metabolism
    Coenzyme transport and metabolism
    Transcription
    Translation, ribosomal structure and biogenesis
    Cell wall/membrane/envelope biogenesis
    Replication, recombination and repair
    Posttranslational modification, protein turnover, chaperones
    Cell motility
    Secondary metabolites biosynthesis, transport and catabolism
    Inorganic ion transport and metabolism
    Function unknown
    General function prediction only
    Intracellular trafficking, secretion, and vesicular transport
    Signal transduction mechanisms
    Extracellular structures
    Defense mechanisms
    Nuclear structure
    Cytoskeleton
  • BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)
  • Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
    Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
  • BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)
  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3610c (ftsH)

    PropertyValueCreatorEvidencePMIDComment
    InteractionTranslation Rv0732shahanup86IDAAffinity purification (Physical interaction)
    authors,R. Srinivasan,H. Rajeswari,P. Ajitkumar Analysis of degradation of bacterial cell division protein FtsZ by the ATP-dependent zinc-metalloprotease FtsH in vitro. Microbiol. Res. 2008
    InteractionTranslation Rv2150cshahanup86IDAAffinity purification (Physical interaction)
    authors,R. Srinivasan,H. Rajeswari,P. Ajitkumar Analysis of degradation of bacterial cell division protein FtsZ by the ATP-dependent zinc-metalloprotease FtsH in vitro. Microbiol. Res. 2008
    CitationBacterial cell division protein FtsZ is a specific substrate for the AAA family protease FtsH. authors,G. Anilkumar,R. Srinivasan,SP. Anand,P. Ajitkumar Microbiology (Reading, Engl.) 2001shahanup86IDA11238958Affinity purification (Physical interaction)
    InteractionTranslation Rv0732shahanup86IDAAffinity purification (Physical interaction)
    authors,G. Anilkumar,R. Srinivasan,SP. Anand,P. Ajitkumar Bacterial cell division protein FtsZ is a specific substrate for the AAA family protease FtsH. Microbiology (Reading, Engl.) 2001
    InteractionTranslation Rv2150cshahanup86IDAAffinity purification (Physical interaction)
    authors,G. Anilkumar,R. Srinivasan,SP. Anand,P. Ajitkumar Bacterial cell division protein FtsZ is a specific substrate for the AAA family protease FtsH. Microbiology (Reading, Engl.) 2001
    CitationGenomic organization and in vivo characterization of proteolytic activity of FtsH of Mycobacterium smegmatis SN2. G. Anilkumar, R. Srinivasan et al. Microbiology (Reading, Engl.) 2004shahanup86IDA15289559Affinity purification (Physical interaction)
    InteractionTranslation Rv0732shahanup86IDAAffinity purification (Physical interaction)
    G. Anilkumar, R. Srinivasan et al. Genomic organization and in vivo characterization of proteolytic activity of FtsH of Mycobacterium smegmatis SN2. Microbiology (Reading, Engl.) 2004
    InteractionTranslation Rv2150cshahanup86IDAAffinity purification (Physical interaction)
    G. Anilkumar, R. Srinivasan et al. Genomic organization and in vivo characterization of proteolytic activity of FtsH of Mycobacterium smegmatis SN2. Microbiology (Reading, Engl.) 2004
    InteractionTranslation Rv2150cshahanup86IDAAffinity purification (Physical interaction)
    authors,H. Zheng,L. Lu,B. Wang,S. Pu,X. Zhang,G. Zhu,W. Shi,L. Zhang,H. Wang,S. Wang,G. Zhao,Y. Zhang Genetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv. PLoS ONE 2008
    CitationDegradation of sigma 32, the heat shock regulator in Escherichia coli, is governed by HflB. authors,C. Herman,D. Thvenet,R. D'Ari,P. Bouloc Proc. Natl. Acad. Sci. U.S.A. 1995shahanup86IDA7724592Affinity purification (Physical interaction)
    InteractionTranslation Rv0732shahanup86IDAAffinity purification (Physical interaction)
    authors,C. Herman,D. Thvenet,R. D'Ari,P. Bouloc Degradation of sigma 32, the heat shock regulator in Escherichia coli, is governed by HflB. Proc. Natl. Acad. Sci. U.S.A. 1995
    InteractionTranslation Rv2150cshahanup86IDAAffinity purification (Physical interaction)
    authors,C. Herman,D. Thvenet,R. D'Ari,P. Bouloc Degradation of sigma 32, the heat shock regulator in Escherichia coli, is governed by HflB. Proc. Natl. Acad. Sci. U.S.A. 1995
    CitationCloning and expression of the gene coding for FtsH protease from Mycobacterium tuberculosis H37Rv. G. Anilkumar, MM. Chauhan et al. Gene 1998shahanup86IDA9729123Affinity purification (Physical interaction)
    InteractionTranslation Rv0732shahanup86IDAAffinity purification (Physical interaction)
    G. Anilkumar, MM. Chauhan et al. Cloning and expression of the gene coding for FtsH protease from Mycobacterium tuberculosis H37Rv. Gene 1998
    InteractionTranslation Rv2150cshahanup86IDAAffinity purification (Physical interaction)
    G. Anilkumar, MM. Chauhan et al. Cloning and expression of the gene coding for FtsH protease from Mycobacterium tuberculosis H37Rv. Gene 1998
    CitationAnalysis of degradation of bacterial cell division protein FtsZ by the ATP-dependent zinc-metalloprotease FtsH in vitro. authors,R. Srinivasan,H. Rajeswari,P. Ajitkumar Microbiol. Res. 2008shahanup86IDA16638632Affinity purification (Physical interaction)
    CitationFunctional characterization of AAA family FtsH protease of Mycobacterium tuberculosis. R. Srinivasan, G. Anilkumar et al. FEMS Microbiol. Lett. 2006shahanup86IDA16684108Affinity purification (Physical interaction)
    InteractionTranslation Rv0732shahanup86IDAAffinity purification (Physical interaction)
    R. Srinivasan, G. Anilkumar et al. Functional characterization of AAA family FtsH protease of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2006
    InteractionTranslation Rv2150cshahanup86IDAAffinity purification (Physical interaction)
    R. Srinivasan, G. Anilkumar et al. Functional characterization of AAA family FtsH protease of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2006
    CitationGenetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv. authors,H. Zheng,L. Lu,B. Wang,S. Pu,X. Zhang,G. Zhu,W. Shi,L. Zhang,H. Wang,S. Wang,G. Zhao,Y. Zhang PLoS ONE 2008shahanup86IDA18584054Affinity purification (Physical interaction)
    InteractionTranslation Rv0732shahanup86IDAAffinity purification (Physical interaction)
    authors,H. Zheng,L. Lu,B. Wang,S. Pu,X. Zhang,G. Zhu,W. Shi,L. Zhang,H. Wang,S. Wang,G. Zhao,Y. Zhang Genetic basis of virulence attenuation revealed by comparative genomic analysis of Mycobacterium tuberculosis strain H37Ra versus H37Rv. PLoS ONE 2008
    NameQuality control membrane proteasemjacksonISSCell division
    NameQuality control membrane proteasemjacksonIMPCell division

    Comments