TB Genome Annotation Portal

Rv3610c (ftsH)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ATP-dependent zinc metalloprotease FtsH
  • REFSEQ: membrane-bound protease FTSH (cell division protein)
  • PATRIC: Cell division protein FtsH (EC 3.4.24.-)
  • TUBERCULIST: Membrane-bound protease FtsH (cell division protein)
  • NCBI: Membrane-bound protease FtsH (cell division protein)
  • updated information (H37Rv4):
    • gene name: ftsH
    • function:
    • reference:
• Type: Not Target
• Start: 4050601
• End: 4052883
• Operon:


• Trans-membrane region:
  
• Role: III.C - Cell division
• GO terms:
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0030163 - protein catabolic process (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0010468 - regulation of gene expression (Uniprot)
  • GO:0008237 - metallopeptidase activity (Uniprot)
  • GO:0008233 - peptidase activity (Uniprot)
  • GO:0006979 - response to oxidative stress (Uniprot)
  • GO:0006508 - proteolysis (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0004222 - metalloendopeptidase activity (Uniprot)
  • GO:0004176 - ATP-dependent peptidase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1IY1	70%	Thermus thermophilus	Crystal structure of the FtsH ATPase domain with ADP from Thermus thermophilus
  1IY0	70%	Thermus thermophilus	Crystal structure of the FtsH ATPase domain with AMP-PNP from Thermus thermophilus
  1IXZ	70%	Thermus thermophilus	Crystal structure of the FtsH ATPase domain from Thermus thermophilus
  1LV7	68%	Escherichia coli	Crystal Structure of the AAA domain of FtsH
  1IY2	68%	Thermus thermophilus	Crystal structure of the FtsH ATPase domain from Thermus thermophilus
  2R65	62%	Helicobacter pylori	Crystal structure of Helicobacter pylori ATP dependent protease, FtsH ADP complex
  2R62	62%	Helicobacter pylori	Crystal structure of Helicobacter pylori ATP dependent protease, FtsH
  2CEA	57%	Thermotoga maritima	CELL DIVISION PROTEIN FTSH
  2CE7	57%	Thermotoga maritima	EDTA treated
  3KDS	57%	Thermotoga maritima	apo-FtsH crystal structure

• Links to additional information on ftsH:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -11.624 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MNRKNVTRTITAIAVVVLLGWSFFYFSDDTRGYKPVDTSVAITQINGDNVKSAQIDDREQQLRLILKKGNNETDGSEKVITKYPTGYAVDLFNALSAKNA
KVSTVVNQGSILGELLVYVLPLLLLVGLFVMFSRMQGGARMGFGFGKSRAKQLSKDMPKTTFADVAGVDEAVEELYEIKDFLQNPSRYQALGAKIPKGVL
LYGPPGTGKTLLARAVAGEAGVPFFTISGSDFVEMFVGVGASRVRDLFEQAKQNSPCIIFVDEIDAVGRQRGAGLGGGHDEREQTLNQLLVEMDGFGDRA
GVILIAATNRPDILDPALLRPGRFDRQIPVSNPDLAGRRAVLRVHSKGKPMAADADLDGLAKRTVGMTGADLANVINEAALLTARENGTVITGPALEEAV
DRVIGGPRRKGRIISEQEKKITAYHEGGHTLAAWAMPDIEPIYKVTILARGRTGGHAVAVPEEDKGLRTRSEMIAQLVFAMGGRAAEELVFREPTTGAVS
DIEQATKIARSMVTEFGMSSKLGAVKYGSEHGDPFLGRTMGTQPDYSHEVAREIDEEVRKLIEAAHTEAWEILTEYRDVLDTLAGELLEKETLHRPELES
IFADVEKRPRLTMFDDFGGRIPSDKPPIKTPGELAIERGEPWPQPVPEPAFKAAIAQATQAAEAARSDAGQTGHGANGSPAGTHRSGDRQYGSTQPDYGA
PAGWHAPGWPPRSSHRPSYSGEPAPTYPGQPYPTGQADPGSDESSAEQDDEVSRTKPAHG

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.86 (0.37)	1.24 (0.51)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link