TB Genome Annotation Portal

Rv3540c (ltp2)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: hypothetical protein
  • REFSEQ: lipid-transfer protein
  • PATRIC: Lipid carrier protein IgrF
  • TUBERCULIST: Probable lipid transfer protein or keto acyl-CoA thiolase Ltp2
  • NCBI: Probable lipid transfer protein or keto acyl-CoA thiolase Ltp2
  • updated information (H37Rv4):
    • gene name: ltp2
    • function:
    • reference:
• Type: Conditional
• Start: 3979499
• End: 3980659
• Operon:


• Trans-membrane region:
  
• Role: III.A.5 - Fatty acid transport
• GO terms:
  • GO:0016747 - transferase activity, transferring acyl groups other than amino-acyl groups (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • 3OXO23_24BISNORCHOL4EN17OL22OYL_COA[c] -> PROPIONYLCOA[c] + 4ADSD[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6OK1	70%	Thermomonospora curvata (strain ATCC 19995 / DSM 43183 / JCM 3096 / NBRC 15933 / NCIMB 10081 / Henssen B9)	Ltp2-ChsH2(DUF35) aldolase
  4U4E	38%	Sphaerobacter thermophilus	Crystal structure of putative thiolase from Sphaerobacter thermophilus DSM 20745

• Links to additional information on ltp2:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.879 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VLSGQAAIVGIGATDFSKNSGRSELRLAAEAVLDALADAGLSPTDVDGLTTFTMDTNTEIAVARAAGIGELTFFSKIHYGGGAACATVQHAAMAVATGVA
DVVVAYRAFNERSGMRFGQVQTRLTENADSTGVDNSFSYPHGLSTPAAQVAMIARRYMHLSGATSRDFGAVSVADRKHAANNPKAYFYGKPITIEDHQNS
RWIAEPLRLLDCCQETDGAVAIVVTSAARARDLKQRPVVIEAAAQGCSPDQYTMVSYYRPELDGLPEMGLVGRQLWAQSGLTPADVQTAVLYDHFTPFTL
IQLEELGFCGKGEAKDFIADGAIEVGGRLPINTHGGQLGEAYIHGMNGIAEGVRQLRGTSVNPVAGVEHVLVTAGTGVPTSGLILG

Additional Information