TB Genome Annotation Portal

Rv3328c (sigJ)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: sigma-70 family RNA polymerase sigma factor
  • REFSEQ: RNA polymerase sigma factor SigJ
  • PATRIC: putative RNA polymerase sigma factor
  • TUBERCULIST: Probable alternative RNA polymerase sigma factor (fragment) SigJ
  • NCBI: Probable alternative RNA polymerase sigma factor (fragment) SigJ
  • updated information (H37Rv4):
    • gene name: sigJ
    • function:
    • reference:
• Type: Not Target
• Start: 3713394
• End: 3714332
• Operon:


• Trans-membrane region:
  
• Role: II.A.7 - RNA synthesis, RNA modification and DNA transcription
• GO terms:
  • GO:2000142 - regulation of DNA-templated transcription, initiation (Uniprot)
  • GO:0016987 - bacterial sigma factor activity (Uniprot)
  • GO:0006355 - regulation of transcription, DNA-templated (Uniprot)
  • GO:0006352 - DNA-templated transcription, initiation (Uniprot)
  • GO:0006351 - transcription, DNA-templated (Uniprot)
  • GO:0003700 - DNA binding transcription factor activity (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5XE7	100%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of Mycobacterium tuberculosis extracytoplasmic function sigma factor SigJ
  6TYG	49%	Mycobacterium tuberculosis	Crystal structure of MTB sigma L transcription initiation complex with 9 nt long RNA primer
  6TYF	49%	Mycobacterium tuberculosis	Crystal structure of MTB sigma L transcription initiation complex with 6 nt long RNA primer
  6TYE	49%	Mycobacterium tuberculosis	Crystal structure of MTB sigma L transcription initiation complex with 5 nt long RNA primer
  6DVE	49%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of Mycobacterium tuberculosis transcription initiation complex(ECF selenomethionine-labelled sigma factor L) with 6 nt spacer
  6DVD	49%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of Mycobacterium tuberculosis transcription initiation complex(ECF sigma factor L) with 6 nt spacer and bromine labelled in position "-11
  6DVC	49%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of Mycobacterium tuberculosis transcription initiation complex(ECF sigma factor L) containing 5nt RNA with 6nt spacer
  6DVB	49%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of Mycobacterium tuberculosis transcription initiation complex(ECF sigma factor L) containing 5nt RNA with 5nt spacer
  6DV9	49%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of Mycobacterium tuberculosis transcription initiation complex(ECF sigma factor L) containing 5nt RNA with 4nt spacer

• Links to additional information on sigJ:
  • KEGG - nucleotide and amino acid sequences of gene
  • BioCyc
  • Systems Biology
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.127 (from Jeremy Rock's lab)

Amino Acid Sequence

MEVSEFEALRQHLMSVAYRLTGTVADAEDIVQEAWLRWDSPDTVIADPRAWLTTVVSRLGLDKLRSAAHRRETYTGTWLPEPVVTGLDATDPLAAVVAAE
DARFAAMVVLERLRPDQRVAFVLHDGFAVPFAEVAEVLGTSEAAARQLASRARKAVTAQPALISGDPDPAHNEVVGRLMAAMAAGDLDTVVSLLHPDVTF
TGDSNGKAPTAVRAVRGSDKVVRFILGLVQRYGPGLFGANQLALVNGELGAYTAGLPGVDGYRAMAPRITAITVRDGKVCALWDIANPDKFTGSPLKERR
AQPTGRGRHHRN

Additional Information