TB Genome Annotation Portal

Rv3323c (moaX)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: molybdopterin synthase catalytic subunit
  • REFSEQ: MOAD-MOAE fusion protein MOAX
  • PATRIC: Molybdenum cofactor biosynthesis protein MoaE; Molybdopterin converting factor subunit 2
  • TUBERCULIST: Probable MoaD-MoaE fusion protein MoaX
  • NCBI: Probable MoaD-MoaE fusion protein MoaX
  • updated information (H37Rv4):
    • gene name: moaX
    • function:
    • reference:
• Type: Not Target
• Start: 3709049
• End: 3709714
• Operon:


• Trans-membrane region:
  
• Role: I.B.4 - Glyoxylate bypass
• GO terms:
  • GO:0032324 - molybdopterin cofactor biosynthetic process (Uniprot)
  • GO:0030366 - molybdopterin synthase activity (Uniprot)
  • GO:0006777 - Mo-molybdopterin cofactor biosynthetic process (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2WP4	76%	MYCOBACTERIUM TUBERCULOSIS	crystal structure of Rv3119 from Mycobacterium tuberculosis
  6JC0	40%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Structural analysis of molybdopterin synthases from two mycobacteria pathogens
  4AP8	40%	HOMO SAPIENS	Crystal structure of human Molybdopterin synthase catalytic subunit (MOCS2B)
  2QIE	39%	Staphylococcus aureus	Staphylococcus aureus molybdopterin synthase in complex with precursor Z
  2Q5W	39%	Staphylococcus aureus	The X-ray Crystal Structure of Molybdopterin Synthase from Staphylococcus aureus
  6JBZ	39%	Mycobacterium tuberculosis	Structural analysis of molybdopterin synthases from two mycobacteria pathogens
  5MPO	38%	Homo sapiens	Crystal structure of human molybdopterin synthase complex
  3BII	38%	Escherichia coli	Crystal Structure of Activated MPT Synthase
  2QIE	38%	Staphylococcus aureus	Staphylococcus aureus molybdopterin synthase in complex with precursor Z
  2Q5W	38%	Staphylococcus aureus	The X-ray Crystal Structure of Molybdopterin Synthase from Staphylococcus aureus

• Links to additional information on moaX:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.537 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MITVNVLYFGAVREACKVAHEKISLESGTTVDGLVDQLQIDYPPLADFRKRVRMAVNESIAPASTILDDGDTVAFIPQVAGGSDVYCRLTDEPLSVDEVL
NAISGPSQGGAVIFVGTVRNNNNGHEVTKLYYEAYPAMVHRTLMDIIEECERQADGVRVAVAHRTGELRIGDAAVVIGASAPHRAAAFDAARMCIERLKQ
DVPIWKKEFALDGVEWVANRP

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.81 (0.3)	1.02 (0.4)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link