TB Genome Annotation Portal

Rv3206c (moeB1)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: molybdopterin biosynthesis protein MoeB
  • REFSEQ: molybdopterin biosynthesis-like protein MoeZ
  • PATRIC: Sulfur carrier protein adenylyltransferase ThiF
  • TUBERCULIST: Probable molybdenum cofactor biosynthesis protein MoeB1 (MPT-synthase sulfurylase) (molybdopterin synthase sulphurylase)
  • NCBI: Probable molybdenum cofactor biosynthesis protein MoeB1 (MPT-synthase sulfurylase) (molybdopterin synthase sulphurylase)
  • updated information (H37Rv4):
    • gene name: moeB1
    • function: aka 'moeZR'
    • reference: Voss (2011); PMID: 22140533
• Type: Not Target
• Start: 3582532
• End: 3583710
• Operon:


• Trans-membrane region:
  
• Role: I.G.4 - Molybdopterin
• GO terms:
  • GO:0042783 - active evasion of host immune response (Uniprot)
  • GO:0019344 - cysteine biosynthetic process (Uniprot)
  • GO:0016782 - transferase activity, transferring sulfur-containing groups (Uniprot)
  • GO:0016779 - nucleotidyltransferase activity (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0008641 - ubiquitin-like modifier activating enzyme activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0008146 - sulfotransferase activity (Uniprot)
  • GO:0006535 - cysteine biosynthetic process from serine (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] + CYS[c] + MOAD_COOH[c] -> PPI[c] + AMP[c] + SER[c] + MOAD_COSH[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6YUB	46%	Chaetomium thermophilum	Crystal structure of Uba4 from Chaetomium thermophilum
  6Z6S	45%	Chaetomium thermophilum var. thermophilum DSM 1495	Crystal structure of Uba4-Urm1 from Chaetomium thermophilum
  6YUC	45%	Chaetomium thermophilum	Crystal structure of Uba4-Urm1 from Chaetomium thermophilum
  5FF5	38%	Enterobacter agglomerans	Crystal Structure of SeMet PaaA
  1JWB	37%	Escherichia coli	Structure of the Covalent Acyl-Adenylate Form of the MoeB-MoaD Protein Complex
  1JWA	37%	Escherichia coli	Structure of the ATP-bound MoeB-MoaD Protein Complex
  1JW9	37%	Escherichia coli	Structure of the Native MoeB-MoaD Protein Complex
  6CWZ	36%	Homo sapiens	Crystal structure of apo SUMO E1
  6CWY	36%	Homo sapiens	Crystal structure of SUMO E1 in complex with an allosteric inhibitor
  3KYD	36%	Homo sapiens	Human SUMO E1~SUMO1-AMP tetrahedral intermediate mimic

• Links to additional information on moeB1:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -1.676 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VSTSLPPLVEPASALSREEVARYSRHLIIPDLGVDGQKRLKNARVLVIGAGGLGAPTLLYLAAAGVGTIGIVDFDVVDESNLQRQVIHGVADVGRSKAQS
ARDSIVAINPLIRVRLHELRLAPSNAVDLFKQYDLILDGTDNFATRYLVNDAAVLAGKPYVWGSIYRFEGQASVFWEDAPDGLGVNYRDLYPEPPPPGMV
PSCAEGGVLGIICASVASVMGTEAIKLITGIGETLLGRLLVYDALEMSYRTITIRKDPSTPKITELVDYEQFCGVVADDAAQAAKGSTITPRELRDWLDS
GRKLALIDVRDPVEWDIVHIDGAQLIPKSLINSGEGLAKLPQDRTAVLYCKTGVRSAEALAAVKKAGFSDAVHLQGGIVAWAKQMQPDMVMY

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.69 (0.36)	0.76 (0.31)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link