TB Genome Annotation Portal

Rv3132c (devS)

Amino Acid Sequence

MTTGGLVDENDGAAMRPLRHTLSQLRLHELLVEVQDRVEQIVEGRDRLDGLVEAMLVVTAGLDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVY
EGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAV
ANARLYQQAKARQSWIEATRDIATELLSGTEPATVFRLVAAEALKLTAADAALVAVPVDEDMPAADVGELLVIETVGSAVASIVGRTIPVAGAVLREVFV
NGIPRRVDRVDLEGLDELADAGPALLLPLRARGTVAGVVVVLSQGGPGAFTDEQLEMMAAFADQAALAWQLATSQRRMRELDVLTDRDRIARDLHDHVIQ
RLFAIGLALQGAVPHERNPEVQQRLSDVVDDLQDVIQEIRTTIYDLHGASQGITRLRQRIDAAVAQFADSGLRTSVQFVGPLSVVDSALADQAEAVVREA
VSNAVRHAKASTLTVRVKVDDDLCIEVTDNGRGLPDEFTGSGLTNLRQRAEQAGGEFTLASVPGASGTVLRWSAPLSQ
(Nucleotide sequence available on KEGG)

Additional Information

dosS


Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?YESNO
omega peak height (95%CI lower bound)2.97 (1.11)1.74 (0.65)
codons under selection300, 301, 302, 303, 304, 305
omega plots
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"


ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv3132c/devS, gene len: 1736 bp, num TA sites: 32
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.98)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeYES (LFC=-1.052)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.25)YM rich vs minimal mediumresampling

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3132c (devS)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv3134ckaveri.vermaIPIAffinity purification (Physical interaction)
    G. Bagchi, null. Mayuri et al. Hypoxia-responsive expression of Mycobacterium tuberculosis Rv3134c and devR promoters in Mycobacterium smegmatis. Microbiology (Reading, Engl.) 2003
    InteractionPhysicalInteraction Rv3134ckaveri.vermaIPIAffinity purification (Physical interaction)
    PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
    InteractionPhysicalInteraction Rv3134ckaveri.vermaIPIAffinity purification (Physical interaction)
    JG. Rodriguez, CS. Burbano et al. Rv3134c/devR/devS operon of Mycobacterium bovis BCG is differentially transcribed under in vitro stress conditions. Tuberculosis (Edinburgh, Scotland) 2008
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
    InteractionPhysicalInteraction Rv3134ckaveri.vermaIPIAffinity purification (Physical interaction)
    S. Chauhan & JS. Tyagi Cooperative binding of phosphorylated DevR to upstream sites is necessary and sufficient for activation of the Rv3134c-devRS operon in Mycobacterium tuberculosis: implication in the induction of DevR target genes. J. Bacteriol. 2008
    InteractionPhysicalInteraction Rv3134ckaveri.vermaIPIAffinity purification (Physical interaction)
    null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
    InteractionRegulatory Rv3133cjhum4u2006IEPCo-occurrence (Functional linkage)
    N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
    InteractionRegulatory Rv3133chibeeluckIEPCo-occurrence (Functional linkage)
    N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
    CitationTwo sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. DM. Roberts, RP. Liao et al. J. Biol. Chem. 2004jhum4u2006IEP15033981Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
    CitationDevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. DK. Saini, V. Malhotra et al. Microbiology (Reading, Engl.) 2004jhum4u2006IEP15073296Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
    CitationA GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic J. Mol. Biol. 2005jhum4u2006IEP16213520Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
    CitationDosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. EH. Sousa, JR. Tuckerman et al. Protein Sci. 2007jhum4u2006IEP17600145Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
    CitationMycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Proc. Natl. Acad. Sci. U.S.A. 2007jhum4u2006IEP17609369Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
    CitationCloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. DK. Saini, N. Pant et al. Protein Expr. Purif. 2002jhum4u2006IEP12071717Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
    CitationRv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003jhum4u2006IEP12694625Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
    CitationInhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. MI. Voskuil, D. Schnappinger et al. J. Exp. Med. 2003jhum4u2006IEP12953092Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
    CitationComprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Mol. Cell Proteomics 2003jhum4u2006IEP14532352Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
    CitationThe role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. PJ. Converse, PC. Karakousis et al. Infect. Immun. 2008jhum4u2006IEP19103767Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
    CitationRegulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. DR. Sherman, M. Voskuil et al. Proc. Natl. Acad. Sci. U.S.A. 2001jhum4u2006IEP11416222Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
    CitationCharacterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. N. Dasgupta, V. Kapur et al. Tuber. Lung Dis. 2000jhum4u2006IEP10970762Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
    CitationEvaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Mol. Microbiol. 2002jhum4u2006IEP11929527Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
    CitationMolecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. null. Mayuri, G. Bagchi et al. FEMS Microbiol. Lett. 2002jhum4u2006IEP12076818Affinity purification (Physical interaction)
    CitationDevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. DK. Saini, V. Malhotra et al. Microbiology (Reading, Engl.) 2004hibeeluckIEP15073296Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
    CitationA GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic J. Mol. Biol. 2005hibeeluckIEP16213520Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
    CitationDosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. EH. Sousa, JR. Tuckerman et al. Protein Sci. 2007hibeeluckIEP17600145Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
    CitationMycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Proc. Natl. Acad. Sci. U.S.A. 2007hibeeluckIEP17609369Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
    CitationStructural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang J. Biol. Chem. 2009jhum4u2006IEP19276084Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133cjhum4u2006IEPAffinity purification (Physical interaction)
    HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
    CitationRv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. HD. Park, KM. Guinn et al. Mol. Microbiol. 2003hibeeluckIEP12694625Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
    CitationInhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. MI. Voskuil, D. Schnappinger et al. J. Exp. Med. 2003hibeeluckIEP12953092Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
    CitationComprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Mol. Cell Proteomics 2003hibeeluckIEP14532352Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
    CitationTwo sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. DM. Roberts, RP. Liao et al. J. Biol. Chem. 2004hibeeluckIEP15033981Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
    CitationRegulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. DR. Sherman, M. Voskuil et al. Proc. Natl. Acad. Sci. U.S.A. 2001hibeeluckIEP11416222Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
    CitationCharacterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. N. Dasgupta, V. Kapur et al. Tuber. Lung Dis. 2000hibeeluckIEP10970762Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
    CitationEvaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Mol. Microbiol. 2002hibeeluckIEP11929527Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
    CitationMolecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. null. Mayuri, G. Bagchi et al. FEMS Microbiol. Lett. 2002hibeeluckIEP12076818Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
    CitationCloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. DK. Saini, N. Pant et al. Protein Expr. Purif. 2002hibeeluckIEP12071717Affinity purification (Physical interaction)
    CitationStructural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang J. Biol. Chem. 2009hibeeluckIEP19276084Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
    CitationThe role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. PJ. Converse, PC. Karakousis et al. Infect. Immun. 2008hibeeluckIEP19103767Affinity purification (Physical interaction)
    InteractionRegulatory Rv3133chibeeluckIEPAffinity purification (Physical interaction)
    PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
    InteractionActivates Rv2028cpriti.prietyIEPCoexpression(Functional linkage)
    J. Starck, G. Kllenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
    InteractionActivates Rv2028cpriti.prietyIEPCoexpression(Functional linkage)
    authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978
    InteractionActivates Rv2028cpriti.prietyIEPCoexpression(Functional linkage)
    authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
    InteractionActivates Rv2026cpriti.prietyIEPCoexpression(Functional linkage)
    authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
    InteractionActivatedBy Rv2027cpriti.prietyIDABand Shift
    DK. Saini, V. Malhotra et al. Cross talk between DevS sensor kinase homologue, Rv2027c, and DevR response regulator of Mycobacterium tuberculosis. FEBS Lett. 2004
    InteractionActivatedBy Rv2027cpriti.prietyIDABand Shift
    DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
    InteractionActivates Rv2026cpriti.prietyIEPCoexpression(Functional linkage)
    J. Starck, G. Kllenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
    InteractionActivates Rv2026cpriti.prietyIEPCoexpression(Functional linkage)
    authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    authors,A. Sola-Landa,RS. Moura,JF. Martn The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    JA. Asensio, A. Arbus et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
    InteractionRegulatory Rv0757singhpankaj2116IEPCo-expression (Functional linkage)
    J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
    InteractionRegulatory Rv0375cprabhakarsmailIEPCo-expression (Functional linkage)
    A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
    InteractionRegulatory Rv0374cakankshajain.21IEPCo-expression (Functional linkage)
    A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
    InteractionRegulatory Rv0374cprabhakarsmailIEPCo-expression (Functional linkage)
    A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
    InteractionRegulatory Rv0375cakankshajain.21IEPCo-expression (Functional linkage)
    A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
    InteractionRegulatory Rv0373cakankshajain.21IEPCo-expression (Functional linkage)
    A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
    InteractionRegulatory Rv0373cprabhakarsmailIEPCo-expression (Functional linkage)
    A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
    InteractionRegulatedBy Rv0485yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    RM. Goldstone, SD. Goonesekera et al. The transcriptional regulator Rv0485 modulates the expression of a pe and ppe gene pair and is required for Mycobacterium tuberculosis virulence. Infect. Immun. 2009
    InteractionRegulatedBy Rv0485yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    RM. Goldstone, SD. Goonesekera et al. The transcriptional regulator Rv0485 modulates the expression of a pe and ppe gene pair and is required for Mycobacterium tuberculosis virulence. Infect. Immun. 2009
    InteractionRegulatedBy Rv3833yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3692yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3133cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv2669yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv2017yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0491yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0757yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
    InteractionRegulatedBy Rv3133cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003

    Comments