TB Genome Annotation Portal

Rv3129 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: hypothetical protein
  • REFSEQ: hypothetical protein
  • PATRIC: probable DNA-binding protein
  • TUBERCULIST: Conserved hypothetical protein
  • NCBI: hypothetical protein
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 3494660
• End: 3494992
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0048037 - cofactor binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6ECI	64%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Structure of the FAD binding protein MSMEG_5243 from Mycobacterium smegmatis
  3CP3	47%	Corynebacterium diphtheriae NCTC 13129	Crystal structure of conserved protein of unknown function DIP1874 from Corynebacterium diphtheriae
  3FKH	41%	Corynebacterium glutamicum ATCC 13032	Crystal structure of Putative pyridoxamine 5'-phosphate oxidase (NP_601736.1) from CORYNEBACTERIUM GLUTAMICUM ATCC 13032 KITASATO at 2.51 A resolution

• Links to additional information on Rv3129:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.547 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VVQGRTVLFRTAEGAKLFSAVAKCAVAFEADDHNVAEGWSVIVKVRAQVLTTDAGVREAERAQLLPWTATLKRHCVRVIPWEITGRHFRFGPEPDRSQTF
ACEASSHNQR

Additional Information