TB Genome Annotation Portal

Rv3102c (ftsE)

Amino Acid Sequence

MITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLLAAETPTSGDVRVSKFHVNKLRGRHVPKLRQVIGCVFQDFRLLQQKTVYDN
VAFALEVIGKRTDAINRVVPEVLETVGLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPETSRDIMDLLERINRTGTTVLMATHDHHI
VDSMRQRVVELSLGRLVRDEQRGVYGMDR
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)2.43 (0.43)1.65 (0.55)
codons under selection
omega plots
genetic variantslinklink
statistics at each codonlinklink

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Uncertain Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.965650;
8 non-insertions in a row out of 8 sites
Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.994900;
8 non-insertions in a row out of 8 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.996450;
8 non-insertions in a row out of 8 sites
Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.997150;
9 non-insertions in a row out of 9 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.001300;
6 non-insertions in a row out of 9 sites
Growth-Defect 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Growth-Defect C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.58
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv3102c (ftsE)

    PropertyValueCreatorEvidencePMIDComment
    CitationMolecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. MA. Mir, HS. Rajeswari et al. Arch. Microbiol. 2006ilamathi.rajaIPI16416128Affinity purification (Physical interaction)
    InteractionPhysicalInteraction Rv3101cilamathi.rajaIPIAffinity purification (Physical interaction)
    MA. Mir, HS. Rajeswari et al. Molecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. Arch. Microbiol. 2006
    InteractionPhysicalInteraction Rv2150cilamathi.rajaIPIAffinity purification (Physical interaction)
    MA. Mir, HS. Rajeswari et al. Molecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. Arch. Microbiol. 2006
    InteractionPhysicalInteraction Rv3101cilamathi.rajaIPIAffinity purification (Physical interaction)
    MA. Mir, HS. Rajeswari et al. Molecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. Arch. Microbiol. 2006
    InteractionPhysicalInteraction Rv2150caparna.vchalamIPIAffinity purification (physical interaction)
    P. Datta, A. Dasgupta et al. Interaction between FtsZ and FtsW of Mycobacterium tuberculosis. J. Biol. Chem. 2002
    InteractionPhysicalInteraction Rv2150cpriyadarshinipriyanka2001IPIAffinity purification (physical interaction)
    P. Datta, A. Dasgupta et al. Interaction between FtsZ and FtsW of Mycobacterium tuberculosis. J. Biol. Chem. 2002
    InteractionRegulatedBy Rv0182cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
    NameIntegral membrane protein component of an ABC transporter for a septation componentmjacksonISSCell division
    NameIntegral membrane protein component of an ABC transporter for a septation componentmjacksonIMPCell division
    SymbolFtsErslayden
    authors,S. Roy,S. Vijay,M. Arumugam,D. Anand,M. Mir,P. Ajitkumar Mycobacterium tuberculosis expresses ftsE gene through multiple transcripts. Curr. Microbiol. 2011
    NameCell division protein,Z-ring complex Iarslayden
    authors,S. Roy,S. Vijay,M. Arumugam,D. Anand,M. Mir,P. Ajitkumar Mycobacterium tuberculosis expresses ftsE gene through multiple transcripts. Curr. Microbiol. 2011
    CitationMycobacterium tuberculosis expresses ftsE gene through multiple transcripts. authors,S. Roy,S. Vijay,M. Arumugam,D. Anand,M. Mir,P. Ajitkumar Curr. Microbiol. 2011rslayden21336990None
    SymbolFtsErslayden
    MA. Mir, HS. Rajeswari et al. Molecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. Arch. Microbiol. 2006
    NameCell division protein,Z-ring complex Iarslayden
    MA. Mir, HS. Rajeswari et al. Molecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. Arch. Microbiol. 2006
    CitationMolecular characterisation of ABC transporter type FtsE and FtsX proteins of Mycobacterium tuberculosis. MA. Mir, HS. Rajeswari et al. Arch. Microbiol. 2006rslayden16416128None

    Comments