TB Genome Annotation Portal

Rv3102c (ftsE)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: type II (General) Secretory Pathway (IISP) Family protein
  • REFSEQ: putative cell division ATP-binding protein FTSE (septation component-transport ATP-binding protein ABC transporter)
  • PATRIC: Cell division transporter ATP-binding protein FtsE (TC 3.A.5.1.1)
  • TUBERCULIST: Putative cell division ATP-binding protein FtsE (septation component-transport ATP-binding protein ABC transporter)
  • NCBI: Putative cell division ATP-binding protein FtsE (septation component-transport ATP-binding protein ABC transporter)
  • updated information (H37Rv4):
    • gene name: ftsE
    • function:
    • reference:
• Type: Not Target
• Start: 3470680
• End: 3471369
• Operon:


• Trans-membrane region:
  
• Role: III.C - Cell division
• GO terms:
  • GO:0051301 - cell division (Uniprot)
  • GO:0030145 - manganese ion binding (Uniprot)
  • GO:0016887 - ATPase activity (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0007049 - cell cycle (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0000287 - magnesium ion binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6Z67	52%	Streptococcus pneumoniae	FtsE structure of Streptococcus pneumoniae in complex with AMPPNP at 2.4 A resolution
  6Z63	52%	Streptococcus pneumoniae	FtsE structure from Streptococus pneumoniae in complex with ADP at 1.57 A resolution (spacegroup P 21)
  6Z4W	52%	Streptococcus pneumoniae	FtsE structure from Streptococcus pneumoniae in complex with ADP (space group P 1)
  3DHW	40%	Escherichia coli	Crystal structure of methionine importer MetNI
  1F3O	40%	Methanocaldococcus jannaschii	Crystal structure of MJ0796 ATP-binding cassette
  5XU1	40%	Streptococcus pneumoniae (strain ATCC BAA-255 / R6)	Structure of a non-canonical ABC transporter from Streptococcus pneumoniae R6
  6CVL	40%	Escherichia coli (strain K12)	Crystal structure of the Escherichia coli ATPgS-bound MetNI methionine ABC transporter in complex with its MetQ binding protein
  3TUZ	40%	Escherichia coli	Inward facing conformations of the MetNI methionine ABC transporter: CY5 SeMet soak crystal form
  3TUJ	40%	Escherichia coli	Inward facing conformations of the MetNI methionine ABC transporter: DM crystal form
  3TUI	40%	Escherichia coli	Inward facing conformations of the MetNI methionine ABC transporter: CY5 native crystal form

• Links to additional information on ftsE:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -7.524 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MITLDHVTKQYKSSARPALDDINVKIDKGEFVFLIGPSGSGKSTFMRLLLAAETPTSGDVRVSKFHVNKLRGRHVPKLRQVIGCVFQDFRLLQQKTVYDN
VAFALEVIGKRTDAINRVVPEVLETVGLSGKANRLPDELSGGEQQRVAIARAFVNRPLVLLADEPTGNLDPETSRDIMDLLERINRTGTTVLMATHDHHI
VDSMRQRVVELSLGRLVRDEQRGVYGMDR

Additional Information