TB Genome Annotation Portal

Rv3017c (esxQ)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: ESAT-6-like protein esxQ
  • REFSEQ: Esat-6 like protein esxQ (TB12.9) (Esat-6 like protein 8)
  • PATRIC: ESAT-6-like protein EsxQ
  • TUBERCULIST: ESAT-6 like protein EsxQ (TB12.9) (ESAT-6 like protein 8)
  • NCBI: ESAT-6 like protein EsxQ (TB12.9) (ESAT-6 like protein 8)
  • updated information (H37Rv4):
    • gene name: esxQ
    • function:
    • reference:
• Type: Not Target
• Start: 3376490
• End: 3376852
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0005576 - extracellular region (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3H6P	66%	Mycobacterium tuberculosis	Crystal structure of Rv3019c-Rv3020c from Mycobacterium tuberculosis
  2KG7	65%	Mycobacterium tuberculosis	Structure and features of the complex formed by the tuberculosis virulence factors Rv0287 and Rv0288
  3Q4H	58%	Mycobacterium smegmatis	Crystal structure of the Mycobacterium smegmatis EsxGH complex (MSMEG_0620-MSMEG_0621)

• Links to additional information on esxQ:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.146 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VSQSMYSYPAMTANVGDMAGYTGTTQSLGADIASERTAPSRACQGDLGMSHQDWQAQWNQAMEALARAYRRCRRALRQIGVLERPVGDSSDCGTIRVGSF
RGRWLDPRHAGPATAADAGD

Additional Information