TB Genome Annotation Portal

Rv2935 (ppsE)

Amino Acid Sequence

VSIPENAIAVVGMAGRFPGAKDVSAFWSNLRRGKESIVTLSEQELRDAGVSDKTLADPAYVRRAPLLDGIDEFDAGFFGFPPLAAQVLDPQHRLFLQCAW
HALEDAGADPARFDGSIGVYGTSSPSGYLLHNLLSHRDPNAVLAEGLNFDQFSLFLQNDKDFLATRISHAFNLRGPSIAVQTACSSSLVAVHLACLSLLS
GECDMALAGGSSLCIPHRVGYFTSPGSMVSAVGHCRPFDVRADGTVFGSGVGLVVLKPLAAAIDAGDRIHAVIRGSAINNDGSAKMGYAAPNPAAQADVI
AEAHAVSGIDSSTVSYVECHGTGTPLGDPIEIQGLRAAFEVSQTSRSAPCVLGSVKSNIGHLEVAAGIAGLIKTILCLKNKALPATLHYTSPNPELRLDQ
SPFVVQSKYGPWECDGVRRAGVSSFGVGGTNAHVVLEEAPAEASEVSAHAEPAGPQVILLSAQTAAALGESRTALAAALETQDGPRLSDVAYTLARRRKH
NVTMAAVVHDREHAATVLRAAEHDNVFVGEAAHDGEHGDRADAAPTSDRVVFLFPGQGAQHVGMAKGLYDTEPVFAQHFDTCAAGFRDETGIDLHAEVFD
GTATDLERIDRSQPALFTVEYALAKLVDTFGVRAGAYIGYSTGEYIAATLAGVFDLQTAIKTVSLRARLMHESPPGAMVAVALGPDDVTQYLPPEVELSA
VNDPGNCVVAGPKDQIRALRQRLTEAGIPVRRVRATHAFHTSAMDPMLGQFQEFLSRQQLRPPRTPLLSNLTGSWMSDQQVVDPASWTRQISSPIRFADE
LDVVLAAPSRILVEVGPGGSLTGSAMRHPKWSTTHRTVRLMRHPLQDVDDRDTFLRALGELWSAGVEVDWTPRRPAVPHLVSLPGYPFARQRHWVEPNHT
VWAQAPGANNGSPAGTADGSTAATVDAARNGESQTEVTLQRIWSQCLGVSSVDRNANFFDLGGDSLMAISIAMAAANEGLTITPQDLYEYPTLASLTAAV
DASFASSGLAKPPEAQANPAVPPNVTYFLDRGLRDTGRCRVPLILRLDPKIGLPDIRAVLTAVVNHHDALRLHLVGNDGIWEQHIAAPAEFTGLSNRSVP
NGVAAGSPEERAAVLGILAELLEDQTDPNAPLAAVHIAAAHGGPHYLCLAIHAMVTDDSSRQILATDIVTAFGQRLAGEEITLEPVSTGWREWSLRCAAL
ATHPAALDTRSYWIENSTKATLWLADALPNAHTAHPPRADELTKLSSTLSVEQTSELDDGRRRFRRSIQTILLAALGRTIAQTVGEGVVAVELEGEGRSV
LRPDVDLRRTVGWFTTYYPVPLACATGLGALAQLDAVHNTLKSVPHYGIGYGLLRYVYAPTGRVLGAQRTPDIHFRYAGVIPELPSGDAPVQFDSDMTLP
VREPIPGMGHAIELRVYRFGGSLHLDWWYDTRRIPAATAEALERTFPLALSALIQEAIAAEHTEHDDSEIVGEPEAGALVDLSSMDAG
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2935/ppsE, gene len: 4466 bp, num TA sites: 68
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.12)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeYES (LFC=0.495)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.13)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)2.29 (0.56)1.95 (0.71)
codons under selection
omega plotsomega plot across ORF for Moldova isolatesomega plot across ORF for CRyPTIC isolates
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2935 (ppsE)

    PropertyValueCreatorEvidencePMIDComment
    CitationGene knockout reveals a novel gene cluster for the synthesis of a class of cell wall lipids unique to pathogenic mycobacteria. authors,AK. Azad,TD. Sirakova,ND. Fernandes,PE. Kolattukudy J. Biol. Chem. 1997njamshidiIDA12031661|15668773|9201977see PMID: 12031661, 9201977, 15668773
    TermTBRXN:PREPTHS2 phenolic phthiocerol precursor synthesis - IDAnjamshidiIDA9201977|15668773|12031661see PMID: 12031661, 9201977, 15668773
    authors,AK. Azad,TD. Sirakova,ND. Fernandes,PE. Kolattukudy Gene knockout reveals a novel gene cluster for the synthesis of a class of cell wall lipids unique to pathogenic mycobacteria. J. Biol. Chem. 1997
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004njamshidiIDA9201977|15668773|12031661see PMID: 12031661, 9201977, 15668773
    TermTBRXN:PREPTHS2 phenolic phthiocerol precursor synthesis - IDAnjamshidiIDA9201977|15668773|12031661see PMID: 12031661, 9201977, 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationThe methyl-branched fortifications of Mycobacterium tuberculosis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra Chem. Biol. 2002njamshidiIDA9201977|15668773|12031661see PMID: 12031661, 9201977, 15668773
    TermTBRXN:PREPTHS2 phenolic phthiocerol precursor synthesis - IDAnjamshidiIDA9201977|15668773|12031661see PMID: 12031661, 9201977, 15668773
    authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
    CitationInteraction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. A. Rao & A. Ranganathan Mol. Genet. Genomics 2004njamshidiIDA9201977|15668773|12031661see PMID: 12031661, 9201977, 15668773
    TermTBRXN:PREPTHS phthiocerol precursor synthesis - IDAnjamshidiIDA9201977|15668773|12031661see PMID: 12031661, 9201977, 15668773
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    CitationThe methyl-branched fortifications of Mycobacterium tuberculosis. authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra Chem. Biol. 2002njamshidiIDA9201977|15668773|12031661see PMID: 12031661, 9201977, 15668773
    TermTBRXN:PREPTHS phthiocerol precursor synthesis - IDAnjamshidiIDA9201977|15668773|12031661see PMID: 12031661, 9201977, 15668773
    authors,DE. Minnikin,L. Kremer,LG. Dover,GS. Besra The methyl-branched fortifications of Mycobacterium tuberculosis. Chem. Biol. 2002
    CitationGene knockout reveals a novel gene cluster for the synthesis of a class of cell wall lipids unique to pathogenic mycobacteria. authors,AK. Azad,TD. Sirakova,ND. Fernandes,PE. Kolattukudy J. Biol. Chem. 1997njamshidiIDA12031661|15668773|9201977see PMID: 12031661, 9201977, 15668773
    TermTBRXN:PREPTHS phthiocerol precursor synthesis - IDAnjamshidiIDA9201977|15668773|12031661see PMID: 12031661, 9201977, 15668773
    authors,AK. Azad,TD. Sirakova,ND. Fernandes,PE. Kolattukudy Gene knockout reveals a novel gene cluster for the synthesis of a class of cell wall lipids unique to pathogenic mycobacteria. J. Biol. Chem. 1997
    InteractionPhysicalInteraction Rv2939shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2939shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2937shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2938shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2939shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    CitationComplex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Nature 1999shahanup86TAS10573420Operon (Functional linkage)
    InteractionPhysicalInteraction Rv2930shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2931shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2932shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2934shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2933shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2936shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2932shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2934shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2933shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2936shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2937shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2938shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2939shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionRegulatory Rv2034ashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    InteractionRegulatory Rv2745cashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    InteractionRegulatory Rv3416ashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    InteractionRegulatory Rv3692ashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    CitationAnalysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. LR. Camacho, P. Constant et al. J. Biol. Chem. 2001shahanup86TAS11279114Operon (Functional linkage)
    InteractionPhysicalInteraction Rv2930shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2931shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionRegulatory Rv0445cashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatory Rv2034ashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatory Rv2745cashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatory Rv3416ashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatory Rv3692ashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    CitationGeneration of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. DM. Collins, B. Skou et al. Infect. Immun. 2005ashwinigbhatIDA15784584One hybrid System
    InteractionRegulatory Rv0117ashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    InteractionRegulatory Rv0445cashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    InteractionPhysicalInteraction Rv2934shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    CitationDissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009ashwinigbhatIDA19228590One hybrid System
    InteractionRegulatory Rv0117ashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionPhysicalInteraction Rv2934shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2933shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2933shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2932shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2932shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2931shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2931shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2930shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2930shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2928razeeth.newIPItwo-hybrid (Physical interaction)
    A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
    InteractionPhysicalInteraction Rv2928razeeth.newIPItwo-hybrid (Physical interaction)
    authors,M. Jackson,G. Stadthagen,B. Gicquel Long-chain multiple methyl-branched fatty acid-containing lipids of Mycobacterium tuberculosis: biosynthesis, transport, regulation and biological activities. Tuberculosis (Edinb) 2007
    InteractionRegulatedBy Rv3911yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
    InteractionRegulatedBy Rv3692yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3416yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv2745cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv1956yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv1359yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0445cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0117yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    NameType 1 polyketide synthase responsible with PpsA-B-C-D for the elongation of C22-C24 fatty acids and p-hydroxyphenylalkanoates with malonyl-CoA and methylmalonyl-CoA to yield phthiocerol and phenolphthiocerol derivatives, respectivelymjacksonIMPPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    NameType 1 polyketide synthase responsible with PpsA-B-C-D for the elongation of C22-C24 fatty acids and p-hydroxyphenylalkanoates with malonyl-CoA and methylmalonyl-CoA to yield phthiocerol and phenolphthiocerol derivatives, respectivelymjacksonIDAPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    CitationDissecting the mechanism and assembly of a complex virulence mycobacterial lipid. OA. Trivedi, P. Arora et al. Mol. Cell 2005mjackson15749014Type 1 polyketide synthase responsible with PpsA-B-C-D for the elongation of C22-C24 fatty acids and p-hydroxyphenylalkanoates with malonyl-CoA and methylmalonyl-CoA to yield phthiocerol and phenolphthiocerol derivatives, respectively (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonType 1 polyketide synthase responsible with PpsA-B-C-D for the elongation of C22-C24 fatty acids and p-hydroxyphenylalkanoates with malonyl-CoA and methylmalonyl-CoA to yield phthiocerol and phenolphthiocerol derivatives, respectively (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OA. Trivedi, P. Arora et al. Dissecting the mechanism and assembly of a complex virulence mycobacterial lipid. Mol. Cell 2005
    CitationComplex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Nature 1999mjackson10573420Type 1 polyketide synthase responsible with PpsA-B-C-D for the elongation of C22-C24 fatty acids and p-hydroxyphenylalkanoates with malonyl-CoA and methylmalonyl-CoA to yield phthiocerol and phenolphthiocerol derivatives, respectively (phenotypic [mycobacterial recombinant strains]; enzymatic)
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonType 1 polyketide synthase responsible with PpsA-B-C-D for the elongation of C22-C24 fatty acids and p-hydroxyphenylalkanoates with malonyl-CoA and methylmalonyl-CoA to yield phthiocerol and phenolphthiocerol derivatives, respectively (phenotypic [mycobacterial recombinant strains]; enzymatic)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    CitationRole of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. P. Constant, E. Perez et al. J. Biol. Chem. 2002jjmcfadden12138124Inferred from direct assay
    OtherEC:jjmcfaddenInferred from direct assay
    P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002

    Comments