TB Genome Annotation Portal

Rv2930 (fadD26)

Amino Acid Sequence

MPVTDRSVPSLLQERADQQPDSTAYTYIDYGSDPKGFADSLTWSQVYSRACIIAEELKLCGLPGDRVAVLAPQGLEYVLAFLGALQAGFIAVPLSTPQYG
IHDDRVSAVLQDSKPVAILTTSSVVGDVTKYAASHDGQPAPVVVEVDLLDLDSPRQMPAFSRQHTGAAYLQYTSGSTRTPAGVIVSHTNVIANVTQSMYG
YFGDPAKIPTGTVVSWLPLYHDMGLILGICAPLVARRRAMLMSPMSFLRRPARWMQLLATSGRCFSAAPNFAFELAVRRTSDQDMAGLDLRDVVGIVSGS
ERIHVATVRRFIERFAPYNLSPTAIRPSYGLAEATLYVAAPEAGAAPKTVRFDYEQLTAGQARPCGTDGSVGTELISYGSPDPSSVRIVNPETMVENPPG
VVGEIWVHGDHVTMGYWQKPKQTAQVFDAKLVDPAPAAPEGPWLRTGDLGVISDGELFIMGRIKDLLIVDGRNHYPDDIEATIQEITGGRAAAIAVPDDI
TEQLVAIIEFKRRGSTAEEVMLKLRSVKREVTSAISKSHSLRVADLVLVSPGSIPITTSGKIRRSACVERYRSDGFKRLDVAV
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.29 (0.2)0.83 (0.22)
codons under selection
omega plots
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"


ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2930/fadD26, gene len: 1751 bp, num TA sites: 40
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.19)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.244)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysgrowth advantageYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, vitamins)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.86)YM rich vs minimal mediumresampling

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:

      • Not downregulated by other genes.


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2930 (fadD26)

    PropertyValueCreatorEvidencePMIDComment
    CitationMolecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004njamshidiIDA15292265see PMID: 15292265
    TermTBRXN:FACOALPREPH fatty-acid--CoA ligase (phthiocerol precursor) - IDAnjamshidiIDA15292265see PMID: 15292265
    E. Prez, P. Constant et al. Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
    CitationMolecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004njamshidiISS15292265see PMID: 15292265
    TermTBRXN:FACOALPREPH fatty-acid--CoA ligase (phthiocerol precursor) - ISSnjamshidiISS15292265see PMID: 15292265
    E. Prez, P. Constant et al. Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
    InteractionPhysicalInteraction Rv2939shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2939shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2935shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2935shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2934shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2934shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2933shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2933shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2932shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2932shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2931shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2931shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2934shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2935shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2936shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2937shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2938shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2939shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2936shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2937shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2938shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2939shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    CitationComplex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Nature 1999shahanup86TAS10573420Operon (Functional linkage)
    InteractionPhysicalInteraction Rv2931shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2932shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionPhysicalInteraction Rv2933shahanup86TASOperon (Functional linkage)
    authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
    InteractionRegulatory Rv3692ashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    CitationAnalysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. LR. Camacho, P. Constant et al. J. Biol. Chem. 2001shahanup86TAS11279114Operon (Functional linkage)
    InteractionPhysicalInteraction Rv2931shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2932shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2933shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2934shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionPhysicalInteraction Rv2935shahanup86TASOperon (Functional linkage)
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    InteractionRegulatory Rv3416ashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatory Rv3692ashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    CitationGeneration of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. DM. Collins, B. Skou et al. Infect. Immun. 2005ashwinigbhatIDA15784584One hybrid System
    InteractionRegulatory Rv0117ashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    InteractionRegulatory Rv0445cashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    InteractionRegulatory Rv2034ashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    InteractionRegulatory Rv2745cashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    InteractionRegulatory Rv3416ashwinigbhatIDAOne hybrid System
    DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
    CitationDissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009ashwinigbhatIDA19228590One hybrid System
    InteractionRegulatory Rv0117ashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatory Rv0445cashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatory Rv2034ashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatory Rv2745cashwinigbhatIDAOne hybrid System
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3692yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv3416yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv2745cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv1956yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv1359yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0445cyamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0117yamir.morenoIDAOne hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
    M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
    InteractionRegulatedBy Rv0981yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
    InteractionRegulatedBy Rv0757yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
    InteractionRegulatedBy Rv0757yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
    InteractionRegulatedBy Rv3286cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
    NameLong-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosatesmjacksonIMPPhthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
    CitationDelineation of the roles of FadD22, FadD26 and FadD29 in the biosynthesis of phthiocerol dimycocerosates and related compounds in Mycobacterium tuberculosis. authors,R. Simone,M. Lger,P. Constant,W. Malaga,H. Marrakchi,M. Daff,C. Guilhot,C. Chalut FEBS J. 2010mjackson20553505Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
    authors,R. Simone,M. Lger,P. Constant,W. Malaga,H. Marrakchi,M. Daff,C. Guilhot,C. Chalut Delineation of the roles of FadD22, FadD26 and FadD29 in the biosynthesis of phthiocerol dimycocerosates and related compounds in Mycobacterium tuberculosis. FEBS J. 2010
    CitationEnzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Nature 2004mjackson15042094Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
    OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Enzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. Nature 2004
    CitationDissecting the mechanism and assembly of a complex virulence mycobacterial lipid. OA. Trivedi, P. Arora et al. Mol. Cell 2005mjackson15749014Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
    OA. Trivedi, P. Arora et al. Dissecting the mechanism and assembly of a complex virulence mycobacterial lipid. Mol. Cell 2005
    CitationAnalysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. LR. Camacho, P. Constant et al. J. Biol. Chem. 2001mjackson11279114Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
    OtherTBPWY:Phthiocerol dimycocerosates, PGL & pHBADmjacksonLong-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
    LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
    CitationRole of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. P. Constant, E. Perez et al. J. Biol. Chem. 2002jjmcfadden12138124Inferred from direct assay
    TermEC:6.2.1.3 Long-chain-fatty-acid--CoA ligase. - NRjjmcfaddenNRInferred from direct assay
    P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002

    Comments