Rv2930 (fadD26)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: long chain fatty acid CoA FadD26
- REFSEQ: acyl-CoA synthetase
- PATRIC: Long-chain-fatty-acid--CoA ligase (EC 6.2.1.3)
- TUBERCULIST: Fatty-acid-AMP ligase FadD26 (fatty-acid-AMP synthetase) (fatty-acid-AMP synthase)
- NCBI: Fatty-acid-AMP ligase FadD26 (fatty-acid-AMP synthetase) (fatty-acid-AMP synthase)
- updated information (H37Rv4):
  - gene name: fadD26
  - function:
  - reference:
Type: Not Target
Start: 3243697
End: 3245448
Operon:

Trans-membrane region:
Role: I.A.3 - Fatty acids
GO terms:
- GO:0097040 - phthiocerol biosynthetic process (Uniprot)
- GO:0071770 - DIM/DIP cell wall layer assembly (Uniprot)
- GO:0071766 - Actinobacterium-type cell wall biogenesis (Uniprot)
- GO:0070566 - adenylyltransferase activity (Uniprot)
- GO:0052572 - response to host immune response (Uniprot)
- GO:0044119 - growth of symbiont in host cell (Uniprot)
- GO:0016878 - acid-thiol ligase activity (Uniprot)
- GO:0016874 - ligase activity (Uniprot)
- GO:0008610 - lipid biosynthetic process (Uniprot)
- GO:0008152 - metabolic process (Uniprot)
- GO:0006633 - fatty acid biosynthetic process (Uniprot)
- GO:0006631 - fatty acid metabolic process (Uniprot)
- GO:0006629 - lipid metabolic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005524 - ATP binding (Uniprot)
- GO:0003824 - catalytic activity (Uniprot)
- GO:0000166 - nucleotide binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- 2 SMMALONYLCOA[c] + 3 MALCOA[c] + PHPAA_COA[c] -> 5 CO2[c] + 5 COA[c] + PHENOLPHTHIODIOLONE[A][c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
3E53	57%	Mycobacterium tuberculosis	Crystal structure of N-terminal domain of a Fatty Acyl AMP Ligase FAAL28 from Mycobacterium tuberculosis
3T5A	56%	Mycobacterium tuberculosis	Crystal structure of N-terminal domain of FAAL28 G330W mutant from Mycobacterium tuberculosis
5HM3	39%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	2.25 Angstrom Resolution Crystal Structure of Long-chain-fatty-acid-AMP Ligase FadD32 from Mycobacterium tuberculosis in complex with Inhibitor 5'-O-[(11-phenoxyundecanoyl)sulfamoyl]adenosine
5EY9	39%	Mycobacterium marinum	Structure of FadD32 from Mycobacterium marinum complexed to AMPC12
5D6N	39%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of a mycobacterial protein
5ICR	38%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	2.25 Angstrom Resolution Crystal Structure of Fatty-Acid-CoA Ligase (FadD32) from Mycobacterium smegmatis in complex with Inhibitor 5'-O-[(11-phenoxyundecanoyl)sulfamoyl]adenosine.
5EY8	38%	Mycobacterium smegmatis	Structure of FadD32 from Mycobacterium smegmatis complexed to AMPC20
5D6J	38%	Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)	Crystal structure of a mycobacterial protein

Links to additional information on fadD26:
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.61 (from Jeremy Rock's lab)

Amino Acid Sequence

MPVTDRSVPSLLQERADQQPDSTAYTYIDYGSDPKGFADSLTWSQVYSRACIIAEELKLCGLPGDRVAVLAPQGLEYVLAFLGALQAGFIAVPLSTPQYG
IHDDRVSAVLQDSKPVAILTTSSVVGDVTKYAASHDGQPAPVVVEVDLLDLDSPRQMPAFSRQHTGAAYLQYTSGSTRTPAGVIVSHTNVIANVTQSMYG
YFGDPAKIPTGTVVSWLPLYHDMGLILGICAPLVARRRAMLMSPMSFLRRPARWMQLLATSGRCFSAAPNFAFELAVRRTSDQDMAGLDLRDVVGIVSGS
ERIHVATVRRFIERFAPYNLSPTAIRPSYGLAEATLYVAAPEAGAAPKTVRFDYEQLTAGQARPCGTDGSVGTELISYGSPDPSSVRIVNPETMVENPPG
VVGEIWVHGDHVTMGYWQKPKQTAQVFDAKLVDPAPAAPEGPWLRTGDLGVISDGELFIMGRIKDLLIVDGRNHYPDDIEATIQEITGGRAAAIAVPDDI
TEQLVAIIEFKRRGSTAEEVMLKLRSVKREVTSAISKSHSLRVADLVLVSPGSIPITTSGKIRRSACVERYRSDGFKRLDVAV

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 40 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 40 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 40 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000050; 8 non-insertions in a row out of 40 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 5 non-insertions in a row out of 40 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.05
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0081 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1033c (trcR) (Direct binding)
- Rv1423 (whiA) (Direct binding)
- Rv2034 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0081 (-)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv2930 (fadD26)

Property	Value	Creator	Evidence	PMID	Comment
Citation	Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004	njamshidi	IDA	15292265	see PMID: 15292265
Term	TBRXN:FACOALPREPH fatty-acid--CoA ligase (phthiocerol precursor) - IDA	njamshidi	IDA	15292265	see PMID: 15292265 E. Prez, P. Constant et al. Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
Citation	Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004	njamshidi	ISS	15292265	see PMID: 15292265
Term	TBRXN:FACOALPREPH fatty-acid--CoA ligase (phthiocerol precursor) - ISS	njamshidi	ISS	15292265	see PMID: 15292265 E. Prez, P. Constant et al. Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2939	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2939	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2935	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2935	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2934	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2934	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2933	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2933	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2932	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2932	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2931	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2931	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2934	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2935	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2936	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2937	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2938	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2939	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2936	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2937	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2938	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2939	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Citation	Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Nature 1999	shahanup86	TAS	10573420	Operon (Functional linkage)
Interaction	PhysicalInteraction Rv2931	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2932	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	PhysicalInteraction Rv2933	shahanup86	TAS		Operon (Functional linkage) authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999
Interaction	Regulatory Rv3692	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Citation	Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. LR. Camacho, P. Constant et al. J. Biol. Chem. 2001	shahanup86	TAS	11279114	Operon (Functional linkage)
Interaction	PhysicalInteraction Rv2931	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2932	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2933	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2934	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2935	shahanup86	TAS		Operon (Functional linkage) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Interaction	Regulatory Rv3416	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv3692	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Citation	Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. DM. Collins, B. Skou et al. Infect. Immun. 2005	ashwinigbhat	IDA	15784584	One hybrid System
Interaction	Regulatory Rv0117	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv0445c	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2034	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv2745c	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Interaction	Regulatory Rv3416	ashwinigbhat	IDA		One hybrid System DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005
Citation	Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009	ashwinigbhat	IDA	19228590	One hybrid System
Interaction	Regulatory Rv0117	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv0445c	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2034	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulatory Rv2745c	ashwinigbhat	IDA		One hybrid System M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3692	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2745c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1956	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1359	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0445c	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0117	yamir.moreno	IDA		One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0981	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0757	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv0757	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv3286c	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Name	Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates	mjackson	IMP		Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Citation	Delineation of the roles of FadD22, FadD26 and FadD29 in the biosynthesis of phthiocerol dimycocerosates and related compounds in Mycobacterium tuberculosis. authors,R. Simone,M. Lger,P. Constant,W. Malaga,H. Marrakchi,M. Daff,C. Guilhot,C. Chalut FEBS J. 2010	mjackson		20553505	Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	mjackson			Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains]) authors,R. Simone,M. Lger,P. Constant,W. Malaga,H. Marrakchi,M. Daff,C. Guilhot,C. Chalut Delineation of the roles of FadD22, FadD26 and FadD29 in the biosynthesis of phthiocerol dimycocerosates and related compounds in Mycobacterium tuberculosis. FEBS J. 2010
Citation	Enzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Nature 2004	mjackson		15042094	Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	mjackson			Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains]) OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Enzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. Nature 2004
Citation	Dissecting the mechanism and assembly of a complex virulence mycobacterial lipid. OA. Trivedi, P. Arora et al. Mol. Cell 2005	mjackson		15749014	Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	mjackson			Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains]) OA. Trivedi, P. Arora et al. Dissecting the mechanism and assembly of a complex virulence mycobacterial lipid. Mol. Cell 2005
Citation	Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. LR. Camacho, P. Constant et al. J. Biol. Chem. 2001	mjackson		11279114	Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	mjackson			Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains]) LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001
Citation	Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. P. Constant, E. Perez et al. J. Biol. Chem. 2002	jjmcfadden		12138124	Inferred from direct assay
Term	EC:6.2.1.3 Long-chain-fatty-acid--CoA ligase. - NR	jjmcfadden	NR		Inferred from direct assay P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002

Property

Value

Creator

Evidence

PMID

Comment

Citation

Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. E. Prez, P. Constant et al. J. Biol. Chem. 2004

njamshidi

IDA

15292265

see PMID: 15292265

Term

TBRXN:FACOALPREPH fatty-acid--CoA ligase (phthiocerol precursor) - IDA

njamshidi

IDA

15292265

see PMID: 15292265
E. Prez, P. Constant et al. Molecular dissection of the role of two methyltransferases in the biosynthesis of phenolglycolipids and phthiocerol dimycoserosate in the Mycobacterium tuberculosis complex. J. Biol. Chem. 2004

Citation

njamshidi

ISS

15292265

see PMID: 15292265

Term

TBRXN:FACOALPREPH fatty-acid--CoA ligase (phthiocerol precursor) - ISS

njamshidi

ISS

15292265

Interaction

PhysicalInteraction Rv2939

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2939

shahanup86

TAS

Operon (Functional linkage)
LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001

Interaction

PhysicalInteraction Rv2935

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2935

shahanup86

TAS

Interaction

PhysicalInteraction Rv2934

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2934

shahanup86

TAS

Interaction

PhysicalInteraction Rv2933

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2933

shahanup86

TAS

Interaction

PhysicalInteraction Rv2932

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2932

shahanup86

TAS

Interaction

PhysicalInteraction Rv2931

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2931

shahanup86

TAS

Interaction

PhysicalInteraction Rv2934

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2935

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2936

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2937

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2938

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2939

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2936

shahanup86

TAS

Interaction

PhysicalInteraction Rv2937

shahanup86

TAS

Interaction

PhysicalInteraction Rv2938

shahanup86

TAS

Interaction

PhysicalInteraction Rv2939

shahanup86

TAS

Citation

Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Nature 1999

shahanup86

TAS

10573420

Operon (Functional linkage)

Interaction

PhysicalInteraction Rv2931

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2932

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

PhysicalInteraction Rv2933

shahanup86

TAS

Operon (Functional linkage)
authors,JS. Cox,B. Chen,M. McNeil,WR. Jacobs Complex lipid determines tissue-specific replication of Mycobacterium tuberculosis in mice. Nature 1999

Interaction

Regulatory Rv3692

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Citation

Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. LR. Camacho, P. Constant et al. J. Biol. Chem. 2001

shahanup86

TAS

11279114

Operon (Functional linkage)

Interaction

PhysicalInteraction Rv2931

shahanup86

TAS

Interaction

PhysicalInteraction Rv2932

shahanup86

TAS

Interaction

PhysicalInteraction Rv2933

shahanup86

TAS

Interaction

PhysicalInteraction Rv2934

shahanup86

TAS

Interaction

PhysicalInteraction Rv2935

shahanup86

TAS

Interaction

Regulatory Rv3416

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv3692

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Citation

Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. DM. Collins, B. Skou et al. Infect. Immun. 2005

ashwinigbhat

IDA

15784584

One hybrid System

Interaction

Regulatory Rv0117

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Interaction

Regulatory Rv0445c

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Interaction

Regulatory Rv2034

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Interaction

Regulatory Rv2745c

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Interaction

Regulatory Rv3416

ashwinigbhat

IDA

One hybrid System
DM. Collins, B. Skou et al. Generation of attenuated Mycobacterium bovis strains by signature-tagged mutagenesis for discovery of novel vaccine candidates. Infect. Immun. 2005

Citation

Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. M. Guo, H. Feng et al. Genome Res. 2009

ashwinigbhat

IDA

19228590

One hybrid System

Interaction

Regulatory Rv0117

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv0445c

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv2034

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

Regulatory Rv2745c

ashwinigbhat

IDA

One hybrid System
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

RegulatedBy Rv3692

yamir.moreno

IDA

One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. .
M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009

Interaction

RegulatedBy Rv3416

yamir.moreno

IDA

Interaction

RegulatedBy Rv2745c

yamir.moreno

IDA

Interaction

RegulatedBy Rv1956

yamir.moreno

IDA

Interaction

RegulatedBy Rv1359

yamir.moreno

IDA

Interaction

RegulatedBy Rv0445c

yamir.moreno

IDA

Interaction

RegulatedBy Rv0117

yamir.moreno

IDA

Interaction

RegulatedBy Rv0981

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006

Interaction

RegulatedBy Rv0757

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006

Interaction

RegulatedBy Rv0757

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006

Interaction

RegulatedBy Rv3286c

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007

Name

mjackson

IMP

Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives

Citation

Delineation of the roles of FadD22, FadD26 and FadD29 in the biosynthesis of phthiocerol dimycocerosates and related compounds in Mycobacterium tuberculosis. authors,R. Simone,M. Lger,P. Constant,W. Malaga,H. Marrakchi,M. Daff,C. Guilhot,C. Chalut FEBS J. 2010

mjackson

20553505

Other

TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD

mjackson

Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
authors,R. Simone,M. Lger,P. Constant,W. Malaga,H. Marrakchi,M. Daff,C. Guilhot,C. Chalut Delineation of the roles of FadD22, FadD26 and FadD29 in the biosynthesis of phthiocerol dimycocerosates and related compounds in Mycobacterium tuberculosis. FEBS J. 2010

Citation

Enzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Nature 2004

mjackson

15042094

Other

TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD

mjackson

Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
OA. Trivedi,P. Arora,V. Sridharan,R. Tickoo,D. Mohanty,RS. Gokhale Enzymic activation and transfer of fatty acids as acyl-adenylates in mycobacteria. Nature 2004

Citation

Dissecting the mechanism and assembly of a complex virulence mycobacterial lipid. OA. Trivedi, P. Arora et al. Mol. Cell 2005

mjackson

15749014

Other

TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD

mjackson

Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
OA. Trivedi, P. Arora et al. Dissecting the mechanism and assembly of a complex virulence mycobacterial lipid. Mol. Cell 2005

Citation

mjackson

11279114

Other

TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD

mjackson

Long-chain fatty acyl-AMP ligase responsible for providing and loading the long-chain fatty acid starter unit onto PpsA for the generation of phthiocerol in the biosynthesis of phthiocerol dimycocerosates (phenotypic [mycobacterial recombinant strains])
LR. Camacho, P. Constant et al. Analysis of the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Evidence that this lipid is involved in the cell wall permeability barrier. J. Biol. Chem. 2001

Citation

Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. P. Constant, E. Perez et al. J. Biol. Chem. 2002

jjmcfadden

12138124

Inferred from direct assay

Term

EC:6.2.1.3 Long-chain-fatty-acid--CoA ligase. - NR

jjmcfadden

Inferred from direct assay
P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002

Comments