TB Genome Annotation Portal

Rv2875 (mpt70)

Amino Acid Sequence

MKVKNTIAATSFAAAGLAALAVAVSPPAAAGDLVGPGCAEYAAANPTGPASVQGMSQDPVAVAASNNPELTTLTAALSGQLNPQVNLVDTLNSGQYTVFA
PTNAAFSKLPASTIDELKTNSSLLTSILTYHVVAGQTSPANVVGTRQTLQGASVTVTGQGNSLKVGNADVVCGGVSTANATVYMIDSVLMPPA
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2875/mpt70, gene len: 581 bp, num TA sites: 13
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Micronon-essential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathnon-essentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.06)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.291)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.48)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.62 (0.18)0.82 (0.24)
codons under selection
omega plotsomega plot across ORF for Moldova isolatesomega plot across ORF for CRyPTIC isolates
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2875 (mpt70)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv2872priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,K. Miura,S. Nagai,M. Kinomoto,S. Haga,T. Tokunaga Comparative studies with various substrains of Mycobacterium bovis BCG on the production of an antigenic protein, MPB70. Infect. Immun. 1983
    CitationEvolution of the mycobacterial SigK regulon. F. Veyrier, B. Sad-Salim et al. J. Bacteriol. 2008shahanup86IPI18203833Affinity purification (Physical interaction)
    InteractionRegulatory Rv0445cshahanup86IPIAffinity purification (Physical interaction)
    F. Veyrier, B. Sad-Salim et al. Evolution of the mycobacterial SigK regulon. J. Bacteriol. 2008
    CitationIdentification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau J. Bacteriol. 2007shahanup86IPI17158685Affinity purification (Physical interaction)
    InteractionRegulatory Rv0445cshahanup86IPIAffinity purification (Physical interaction)
    authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
    CitationT-cell recognition of mycobacterial proteins MPB70 and MPB64 in cattle immunized with antigen and infected with Mycobacterium bovis. authors,KA. Lightbody,RM. Girvin,DP. Mackie,SD. Neill,JM. Pollock Scand. J. Immunol. 1998priti.prietyIEP9714409Gene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,KA. Lightbody,RM. Girvin,DP. Mackie,SD. Neill,JM. Pollock T-cell recognition of mycobacterial proteins MPB70 and MPB64 in cattle immunized with antigen and infected with Mycobacterium bovis. Scand. J. Immunol. 1998
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,KA. Lightbody,RM. Girvin,DP. Mackie,SD. Neill,JM. Pollock T-cell recognition of mycobacterial proteins MPB70 and MPB64 in cattle immunized with antigen and infected with Mycobacterium bovis. Scand. J. Immunol. 1998
    InteractionPhysicalInteraction Rv2872priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,KA. Lightbody,RM. Girvin,DP. Mackie,SD. Neill,JM. Pollock T-cell recognition of mycobacterial proteins MPB70 and MPB64 in cattle immunized with antigen and infected with Mycobacterium bovis. Scand. J. Immunol. 1998
    CitationComparative studies with various substrains of Mycobacterium bovis BCG on the production of an antigenic protein, MPB70. authors,K. Miura,S. Nagai,M. Kinomoto,S. Haga,T. Tokunaga Infect. Immun. 1983priti.prietyIEP6339381Gene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,K. Miura,S. Nagai,M. Kinomoto,S. Haga,T. Tokunaga Comparative studies with various substrains of Mycobacterium bovis BCG on the production of an antigenic protein, MPB70. Infect. Immun. 1983
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,K. Miura,S. Nagai,M. Kinomoto,S. Haga,T. Tokunaga Comparative studies with various substrains of Mycobacterium bovis BCG on the production of an antigenic protein, MPB70. Infect. Immun. 1983
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,HG. Wiker,KP. Lyashchenko,AM. Aksoy,KA. Lightbody,JM. Pollock,SV. Komissarenko,SO. Bobrovnik,IN. Kolesnikova,LO. Mykhalsky,ML. Gennaro,M. Harboe Immunochemical characterization of the MPB70/80 and MPB83 proteins of Mycobacterium bovis. Infect. Immun. 1998
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,HG. Wiker,KP. Lyashchenko,AM. Aksoy,KA. Lightbody,JM. Pollock,SV. Komissarenko,SO. Bobrovnik,IN. Kolesnikova,LO. Mykhalsky,ML. Gennaro,M. Harboe Immunochemical characterization of the MPB70/80 and MPB83 proteins of Mycobacterium bovis. Infect. Immun. 1998
    InteractionPhysicalInteraction Rv2872priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,HG. Wiker,KP. Lyashchenko,AM. Aksoy,KA. Lightbody,JM. Pollock,SV. Komissarenko,SO. Bobrovnik,IN. Kolesnikova,LO. Mykhalsky,ML. Gennaro,M. Harboe Immunochemical characterization of the MPB70/80 and MPB83 proteins of Mycobacterium bovis. Infect. Immun. 1998
    CitationIdentification of bovine T-cell epitopes for three Mycobacterium bovis antigens: MPB70, 19,000 MW and MPB57. authors,JM. Pollock,AJ. Douglas,DP. Mackie,SD. Neill Immunology 1994priti.prietyIEP7519175Gene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,JM. Pollock,AJ. Douglas,DP. Mackie,SD. Neill Identification of bovine T-cell epitopes for three Mycobacterium bovis antigens: MPB70, 19,000 MW and MPB57. Immunology 1994
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,JM. Pollock,AJ. Douglas,DP. Mackie,SD. Neill Identification of bovine T-cell epitopes for three Mycobacterium bovis antigens: MPB70, 19,000 MW and MPB57. Immunology 1994
    InteractionPhysicalInteraction Rv2872priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,JM. Pollock,AJ. Douglas,DP. Mackie,SD. Neill Identification of bovine T-cell epitopes for three Mycobacterium bovis antigens: MPB70, 19,000 MW and MPB57. Immunology 1994
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    M. Harboe, HG. Wiker et al. MPB70 and MPB83 as indicators of protein localization in mycobacterial cells. Infect. Immun. 1998
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    M. Harboe, HG. Wiker et al. MPB70 and MPB83 as indicators of protein localization in mycobacterial cells. Infect. Immun. 1998
    InteractionPhysicalInteraction Rv2872priti.prietyIEPGene Neighborhood (Functional linkage)
    M. Harboe, HG. Wiker et al. MPB70 and MPB83 as indicators of protein localization in mycobacterial cells. Infect. Immun. 1998
    CitationCharacterisation of a lipoprotein in Mycobacterium bovis (BCG) with sequence similarity to the secreted protein MPB70. W. Vosloo, P. Tippoo et al. Gene 1997priti.prietyIEP9099870Gene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    W. Vosloo, P. Tippoo et al. Characterisation of a lipoprotein in Mycobacterium bovis (BCG) with sequence similarity to the secreted protein MPB70. Gene 1997
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    W. Vosloo, P. Tippoo et al. Characterisation of a lipoprotein in Mycobacterium bovis (BCG) with sequence similarity to the secreted protein MPB70. Gene 1997
    InteractionPhysicalInteraction Rv2872priti.prietyIEPGene Neighborhood (Functional linkage)
    W. Vosloo, P. Tippoo et al. Characterisation of a lipoprotein in Mycobacterium bovis (BCG) with sequence similarity to the secreted protein MPB70. Gene 1997
    CitationImmunochemical characterization of the MPB70/80 and MPB83 proteins of Mycobacterium bovis. authors,HG. Wiker,KP. Lyashchenko,AM. Aksoy,KA. Lightbody,JM. Pollock,SV. Komissarenko,SO. Bobrovnik,IN. Kolesnikova,LO. Mykhalsky,ML. Gennaro,M. Harboe Infect. Immun. 1998priti.prietyIEP9529066Gene Neighborhood (Functional linkage)
    CitationComplete nucleotide sequence of immunogenic protein MPB70 from Mycobacterium bovis BCG. authors,K. Terasaka,R. Yamaguchi,K. Matsuo,A. Yamazaki,S. Nagai,T. Yamada FEMS Microbiol. Lett. 1989priti.prietyIEP2663636Gene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,K. Terasaka,R. Yamaguchi,K. Matsuo,A. Yamazaki,S. Nagai,T. Yamada Complete nucleotide sequence of immunogenic protein MPB70 from Mycobacterium bovis BCG. FEMS Microbiol. Lett. 1989
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,K. Terasaka,R. Yamaguchi,K. Matsuo,A. Yamazaki,S. Nagai,T. Yamada Complete nucleotide sequence of immunogenic protein MPB70 from Mycobacterium bovis BCG. FEMS Microbiol. Lett. 1989
    InteractionPhysicalInteraction Rv2872priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,K. Terasaka,R. Yamaguchi,K. Matsuo,A. Yamazaki,S. Nagai,T. Yamada Complete nucleotide sequence of immunogenic protein MPB70 from Mycobacterium bovis BCG. FEMS Microbiol. Lett. 1989
    CitationMPB70, a unique antigen of Mycobacterium bovis BCG. authors,M. Harboe,S. Nagai Am. Rev. Respir. Dis. 1984priti.prietyIEP6367574Gene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,M. Harboe,S. Nagai MPB70, a unique antigen of Mycobacterium bovis BCG. Am. Rev. Respir. Dis. 1984
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,M. Harboe,S. Nagai MPB70, a unique antigen of Mycobacterium bovis BCG. Am. Rev. Respir. Dis. 1984
    InteractionPhysicalInteraction Rv2872priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,M. Harboe,S. Nagai MPB70, a unique antigen of Mycobacterium bovis BCG. Am. Rev. Respir. Dis. 1984
    CitationMPB70 and MPB83 as indicators of protein localization in mycobacterial cells. M. Harboe, HG. Wiker et al. Infect. Immun. 1998priti.prietyIEP9423870Gene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
    InteractionPhysicalInteraction Rv2872priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
    CitationSolution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. authors,MD. Carr,MJ. Bloemink,E. Dentten,AO. Whelan,SV. Gordon,G. Kelly,TA. Frenkiel,RG. Hewinson,RA. Williamson J. Biol. Chem. 2003priti.prietyIEP12917404Gene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,MD. Carr,MJ. Bloemink,E. Dentten,AO. Whelan,SV. Gordon,G. Kelly,TA. Frenkiel,RG. Hewinson,RA. Williamson Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. J. Biol. Chem. 2003
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,MD. Carr,MJ. Bloemink,E. Dentten,AO. Whelan,SV. Gordon,G. Kelly,TA. Frenkiel,RG. Hewinson,RA. Williamson Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. J. Biol. Chem. 2003
    InteractionPhysicalInteraction Rv2872priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,MD. Carr,MJ. Bloemink,E. Dentten,AO. Whelan,SV. Gordon,G. Kelly,TA. Frenkiel,RG. Hewinson,RA. Williamson Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. J. Biol. Chem. 2003
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
    CitationCharacterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. MD. Jurez, A. Torres et al. FEMS Microbiol. Lett. 2001priti.prietyIEP11557146Gene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001

    Comments