TB Genome Annotation Portal

Rv2875 (mpt70)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: immunogenic protein MPT70
  • REFSEQ: major secreted immunogenic protein MPT70
  • PATRIC: Immunogenic protein Mpt70
  • TUBERCULIST: Major secreted immunogenic protein Mpt70
  • NCBI: Major secreted immunogenic protein Mpt70
  • updated information (H37Rv4):
    • gene name: mpt70
    • function:
    • reference:
• Type: Conditional
• Start: 3187030
• End: 3187611
• Operon:


• Trans-membrane region:
  
• Role: II.C.2 - Surface polysaccharides, lipopolysaccharides, proteins and antigens
• GO terms:
  • GO:0030288 - outer membrane-bounded periplasmic space (Uniprot)
  • GO:0005615 - extracellular space (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 1nyo
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  1NYO	100%	Mycobacterium tuberculosis	Solution structure of the antigenic TB protein MPT70/MPB70
  1W7E	42%	RHODOBACTER SPHAEROIDES	NMR Ensemble OF Fasciclin-Like Protein From Rhodobacter sphaeroides
  1W7D	42%	RHODOBACTER SPHAEROIDES	NMR Structure of Fasciclin-Like Protein From Rhodobacter sphaeroides
  5Y6P	40%	Griffithsia pacifica	Structure of the phycobilisome from the red alga Griffithsia pacifica
  6TJV	37%	Thermosynechococcus elongatus (strain BP-1)	Structure of the NDH-1MS complex from Thermosynechococcus elongatus
  2MXA	37%	Thermosynechococcus elongatus	Solution structure of the NDH-1 complex subunit CupS from Thermosynechococcus elongatus
  5NV6	35%	Homo sapiens	Structure of human transforming growth factor beta-induced protein (TGFBIp).

• Links to additional information on mpt70:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.304 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MKVKNTIAATSFAAAGLAALAVAVSPPAAAGDLVGPGCAEYAAANPTGPASVQGMSQDPVAVAASNNPELTTLTAALSGQLNPQVNLVDTLNSGQYTVFA
PTNAAFSKLPASTIDELKTNSSLLTSILTYHVVAGQTSPANVVGTRQTLQGASVTVTGQGNSLKVGNADVVCGGVSTANATVYMIDSVLMPPA

Additional Information