TB Genome Annotation Portal

Rv2873 (mpt83)

Amino Acid Sequence

MINVQAKPAAAASLAAIAIAFLAGCSSTKPVSQDTSPKPATSPAAPVTTAAMADPAADLIGRGCAQYAAQNPTGPGSVAGMAQDPVATAASNNPMLSTLT
SALSGKLNPDVNLVDTLNGGEYTVFAPTNAAFDKLPAATIDQLKTDAKLLSSILTYHVIAGQASPSRIDGTHQTLQGADLTVIGARDDLMVNNAGLVCGG
VHTANATVYMIDTVLMPPAQ
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 13 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 13 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 13 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 14 sites
Non-Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 14 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 1.27
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2873 (mpt83)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv2875priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,KA. Lightbody,RM. Girvin,DP. Mackie,SD. Neill,JM. Pollock T-cell recognition of mycobacterial proteins MPB70 and MPB64 in cattle immunized with antigen and infected with Mycobacterium bovis. Scand. J. Immunol. 1998
    InteractionPhysicalInteraction Rv2875priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,K. Miura,S. Nagai,M. Kinomoto,S. Haga,T. Tokunaga Comparative studies with various substrains of Mycobacterium bovis BCG on the production of an antigenic protein, MPB70. Infect. Immun. 1983
    InteractionPhysicalInteraction Rv2875priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,HG. Wiker,KP. Lyashchenko,AM. Aksoy,KA. Lightbody,JM. Pollock,SV. Komissarenko,SO. Bobrovnik,IN. Kolesnikova,LO. Mykhalsky,ML. Gennaro,M. Harboe Immunochemical characterization of the MPB70/80 and MPB83 proteins of Mycobacterium bovis. Infect. Immun. 1998
    InteractionPhysicalInteraction Rv2875priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,JM. Pollock,AJ. Douglas,DP. Mackie,SD. Neill Identification of bovine T-cell epitopes for three Mycobacterium bovis antigens: MPB70, 19,000 MW and MPB57. Immunology 1994
    InteractionPhysicalInteraction Rv2875priti.prietyIEPGene Neighborhood (Functional linkage)
    M. Harboe, HG. Wiker et al. MPB70 and MPB83 as indicators of protein localization in mycobacterial cells. Infect. Immun. 1998
    InteractionPhysicalInteraction Rv2875priti.prietyIEPGene Neighborhood (Functional linkage)
    W. Vosloo, P. Tippoo et al. Characterisation of a lipoprotein in Mycobacterium bovis (BCG) with sequence similarity to the secreted protein MPB70. Gene 1997
    InteractionPhysicalInteraction Rv2875priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,K. Terasaka,R. Yamaguchi,K. Matsuo,A. Yamazaki,S. Nagai,T. Yamada Complete nucleotide sequence of immunogenic protein MPB70 from Mycobacterium bovis BCG. FEMS Microbiol. Lett. 1989
    InteractionPhysicalInteraction Rv2875priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,M. Harboe,S. Nagai MPB70, a unique antigen of Mycobacterium bovis BCG. Am. Rev. Respir. Dis. 1984
    InteractionPhysicalInteraction Rv2875priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
    InteractionPhysicalInteraction Rv2875priti.prietyIEPGene Neighborhood (Functional linkage)
    authors,MD. Carr,MJ. Bloemink,E. Dentten,AO. Whelan,SV. Gordon,G. Kelly,TA. Frenkiel,RG. Hewinson,RA. Williamson Solution structure of the Mycobacterium tuberculosis complex protein MPB70: from tuberculosis pathogenesis to inherited human corneal desease. J. Biol. Chem. 2003
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
    CitationCharacterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. MD. Jurez, A. Torres et al. FEMS Microbiol. Lett. 2001priti.prietyIEP11557146Gene Neighborhood (Functional linkage)
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
    InteractionPhysicalInteraction Rv2873priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
    InteractionPhysicalInteraction Rv2875priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
    InteractionPhysicalInteraction Rv2874priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
    CitationEvolution of the mycobacterial SigK regulon. F. Veyrier, B. Sad-Salim et al. J. Bacteriol. 2008shahanup86IPI18203833Affinity purification (Physical interaction)
    InteractionRegulatory Rv0445cshahanup86IPIAffinity purification (Physical interaction)
    F. Veyrier, B. Sad-Salim et al. Evolution of the mycobacterial SigK regulon. J. Bacteriol. 2008
    CitationIdentification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau J. Bacteriol. 2007shahanup86IPI17158685Affinity purification (Physical interaction)
    InteractionRegulatory Rv0445cshahanup86IPIAffinity purification (Physical interaction)
    authors,S. Rodrigue,J. Brodeur,PE. Jacques,AL. Gervais,R. Brzezinski,L. Gaudreau Identification of mycobacterial sigma factor binding sites by chromatin immunoprecipitation assays. J. Bacteriol. 2007
    InteractionPhysicalInteraction Rv2872priti.prietyIEPGene Neighborhood (Functional linkage)
    MD. Jurez, A. Torres et al. Characterization of the Mycobacterium tuberculosis region containing the mpt83 and mpt70 genes. FEMS Microbiol. Lett. 2001
    InteractionRegulatory Rv1539shahanup86IMP
    P. Sander, M. Rezwan et al. Lipoprotein processing is required for virulence of Mycobacterium tuberculosis. Mol. Microbiol. 2004
    InteractionRegulatory Rv1539shahanup86IMP
    authors,IK. Dev,PH. Ray Signal peptidases and signal peptide hydrolases. J. Bioenerg. Biomembr. 1990

    Comments