TB Genome Annotation Portal

Rv2748c (ftsK)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: DNA translocase ftsK
  • REFSEQ: cell division transmembrane protein FtsK
  • PATRIC: Cell division protein FtsK
  • TUBERCULIST: Possible cell division transmembrane protein FtsK
  • NCBI: Possible cell division transmembrane protein FtsK
  • updated information (H37Rv4):
    • gene name: ftsK
    • function:
    • reference:
• Type: Not Target
• Start: 3059855
• End: 3062506
• Operon:


• Trans-membrane region:
  
• Role: III.C - Cell division
• GO terms:
  • GO:0051301 - cell division (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0007059 - chromosome segregation (Uniprot)
  • GO:0007049 - cell cycle (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0003677 - DNA binding (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  6T8O	48%	Pseudomonas aeruginosa PAO1	Stalled FtsK motor domain bound to dsDNA end
  6T8G	48%	Pseudomonas aeruginosa PAO1	Stalled FtsK motor domain bound to dsDNA
  6T8B	48%	Pseudomonas aeruginosa PAO1	FtsK motor domain with dsDNA, translocating state
  2IUU	48%	PSEUDOMONAS AERUGINOSA	P. aeruginosa FtsK motor domain, hexamer
  2IUS	46%	ESCHERICHIA COLI	E. coli FtsK motor domain
  2IUT	45%	PSEUDOMONAS AERUGINOSA	P. aeruginosa FtsK motor domain, dimeric
  2VE9	36%	PSEUDOMONAS AERUGINOSA	Xray structure of KOPS bound gamma domain of FtsK (P. aeruginosa)
  2VE8	36%	PSEUDOMONAS AERUGINOSA	Xray structure of FtsK gamma domain (P. aeruginosa)
  2J5O	36%	PSEUDOMONAS AERUGINOSA	Pseudomonas aeruginosa FtsK gamma domain

• Links to additional information on ftsK:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -7.877 (from Jeremy Rock's lab)

Amino Acid Sequence

MLGPPGTPRVGRRDAARSLVTLLRRPWQRGEQIAVTSVADGVDGVIATRLAVMSSKTVARSGTRTSRSKATSRGASRSARSAVPRKRSRPVKGVGRPSRR
HHRSLLVSTGLACGRAMRAVWMMAAKGTGGAARSIGRARDIEPGHRRDGIALVLLGLAVVVAASSWFDAARPLGAWVDALLRTFIGSAVVMLPLVAAAVA
VVLMRTSPNPDSRPRLILGASLIGLSFLGLCHLWAGSPEAPESRLRAAGFIGFAIGGPLSDGLTAWIAAPLLFIGALFGLLLLAGITIREVPDAMRAMFG
TRLLPREYADDFEDFADFDGDDADTVEVARQDFSDGYYDEVPLCSDDGPPAWPSAEVPQDDTATIPEASAGRGSGRRGRRKDTQVLDRIVEGPYTLPSLD
LLISGDPPKKRSAANTHMAGAIGEVLTQFKVDAAVTGCTRGPTVTRYEVELGPGVKVEKITALQRNIAYAVATESVRMLAPIPGKSAVGIEVPNTDREMV
RLADVLTARETRRDHHPLVIGLGKDIEGDFISANLAKMPHLLVAGSTGSGKSSFVNSMLVSLLTRATPEEVRMILIDPKMVELTPYEGIPHLITPIITQP
KKAAAALAWLVDEMEQRYQDMQASRVRHIDDFNDKVRSGAITAPLGSQREYRPYPYVVAIVDELADLMMTAPRDVEDAIVRITQKARAAGIHLVLATQRP
SVDVVTGLIKTNVPSRLAFATSSLTDSRVILDQAGAEKLIGMGDGLFLPMGASKPLRLQGAYVSDEEIHAVVTACKEQAEPEYTEGVTTAKPTAERTDVD
PDIGDDMDVFLQAVELVVSSQFGSTSMLQRKLRVGFAKAGRLMDLMETRGIVGPSEGSKAREVLVKPDELAGTLAAIRGDGGE

Additional Information