Rv2736c (recX)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: regulatory protein recX
- REFSEQ: recombination regulator RecX
- PATRIC: Regulatory protein RecX
- TUBERCULIST: Regulatory protein RecX
- NCBI: Regulatory protein RecX
- updated information (H37Rv4):
  - gene name: recX
  - function:
  - reference:
Type: Not Target
Start: 3048562
End: 3049086
Operon:

Trans-membrane region:
Role: II.A.5 - DNA replication, repair, recombination and restriction/modification
GO terms:
- GO:0006282 - regulation of DNA repair (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005737 - cytoplasm (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on recX:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -0.806 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MTVSCPPPSTSEREEQARALCLRLLTARSRTRAELAGQLAKRGYPEDIGNRVLDRLAAVGLVDDTDFAEQWVQSRRANAAKSKRALAAELHAKGVDDDVI
TTVLGGIDAGAERGRAEKLVRARLRREVLIDDGTDEARVSRRLVAMLARRGYGQTLACEVVIAELAAERERRRV

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 6 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 6 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 6 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 7 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 7 sites
No-Data	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Too-Short	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: -1
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv1219c (-)
- Rv2884 (-)
Downregulates:
- Does not downregulate other genes.
Downregulated by:

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Regulatory Rv2737c	balaganesh727	IEP		Co-expression (Functional linkage) V. Pags, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
Interaction	Regulatory Rv2737c	balaganesh727	IEP		Co-expression (Functional linkage) K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
Interaction	Regulatory Rv2737c	balaganesh727	IEP		Co-expression (Functional linkage) L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
Interaction	Regulatory Rv2737c	balaganesh727	IEP		Co-expression (Functional linkage) KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
Citation	Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. KG. Papavinasasundaram, F. Movahedzadeh et al. Mol. Microbiol. 1997	balaganesh727	IEP	9140972	Co-expression (Functional linkage)
Interaction	Regulatory Rv2737c	balaganesh727	IEP		Co-expression (Functional linkage) KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
Citation	recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. V. Pags, N. Koffel-Schwartz et al. DNA Repair (Amst.) 2003	balaganesh727	IEP	12547390	Co-expression (Functional linkage)
Interaction	Regulatory Rv2737c	balaganesh727	IEP		Co-expression (Functional linkage) V. Pags, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
Other	TBPWY:Recombination repair	vmizrahi			Enhanced expression of recX iowing to a promoter internal to recA
Other	TBPWY:Recombination repair	vmizrahi			Expression enhanced in mouse macrophages

TB Genome Annotation Portal