Rv2717c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: UPF0678 fatty acid-binding protein-like protein
- REFSEQ: hypothetical protein
- PATRIC: DUF1794
- TUBERCULIST: Conserved protein
- NCBI: hypothetical protein
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 3029867
End: 3030361
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- No terms assigned.
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 2fr2
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
6R3Y	100%	Mycobacterium tuberculosis	M.tuberculosis nitrobindin with a cyanide molecule coordinated to the heme iron atom
6R3W	100%	Mycobacterium tuberculosis	M.tuberculosis nitrobindin with a water molecule coordinated to the heme iron atom
2FR2	100%	Mycobacterium tuberculosis	Crystal Structure of Rv2717c from M. tuberculosis
3EMM	39%	Arabidopsis thaliana	X-ray structure of protein from Arabidopsis thaliana AT1G79260 with Bound Heme
2Q4N	39%	Arabidopsis thaliana	Ensemble refinement of the crystal structure of protein from Arabidopsis thaliana At1g79260
2A13	39%	Arabidopsis thaliana	X-ray structure of protein from Arabidopsis thaliana AT1G79260
3WJF	38%	Arabidopsis thaliana	Crystal structure of mutant nitrobindin M75L/H76L/Q96C/V128W/M148L/H158L (NB9) from Arabidopsis thaliana
3WJG	38%	Arabidopsis thaliana	Crystal structure of mutant nitrobindin M75L/H76L/Q96C/M148W/H158L (NB10) from Arabidopsis thaliana
3WJC	38%	Arabidopsis thaliana	Crystal structure of mutant nitrobindin M75L/H76L/Q96C/M148L/H158L covalently linked with [Rh(Cp-Mal)(COD)] (NB4-Rh) from Arabidopsis thaliana
3WJB	38%	Arabidopsis thaliana	Crystal structure of mutant nitrobindin M75L/H76L/Q96C/M148L/H158L (NB4) from Arabidopsis thaliana

Links to additional information on Rv2717c:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.214 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MTRDLAPALQALSPLLGSWAGRGAGKYPTIRPFEYLEEVVFAHVGKPFLTYTQQTRAVADGKPLHSETGYLRVCRPGCVELVLAHPSGITEIEVGTYSVT
GDVIELELSTRADGSIGLAPTAKEVTALDRSYRIDGDELSYSLQMRAVGQPLQDHLAAVLHRQR

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 10 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 10 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 10 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 10 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 10 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.74
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0023 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings to other targets were found.

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0023 (-)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) authors,AP. Pugsley,P. Reeves Increased production of the outer membrane receptors for colicins B, D and M by Escherichia coli under iron starvation. Biochem. Biophys. Res. Commun. 1976
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) authors,JJ. Villafranca,RS. Levy,J. Kernich,T. Vickroy TPN and Mn-isocitrate protect isocitrate dehydrogenase against inactivation but increase the number of modified sulfhydryl groups. Biochem. Biophys. Res. Commun. 1977
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) MB. Mowa, DF. Warner et al. Function and regulation of class I ribonucleotide reductase-encoding genes in mycobacteria. J. Bacteriol. 2008
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) authors,L. Wictorin,H. Fredriksson Microstructure of the solder-casting zone in bridges of dental gold alloys. Odontol Revy 1976
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Citation	[Demonstration of tumor inhibiting properties of a strongly immunostimulating low-molecular weight substance. Comparative studies with ifosfamide on the immuno-labile DS carcinosarcoma. Stimulation of the autoimmune activity for approx. 20 days by BA 1, a N-(2-cyanoethylene)-urea. Novel prophylactic possibilities]. authors,M. Ardenne,PG. Reitnauer Arzneimittelforschung 1975	ahal4789	NAS	22	operon(functional linkage)
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) authors,M. Ardenne,PG. Reitnauer [Demonstration of tumor inhibiting properties of a strongly immunostimulating low-molecular weight substance. Comparative studies with ifosfamide on the immuno-labile DS carcinosarcoma. Stimulation of the autoimmune activity for approx. 20 days by BA 1, a N-(2-cyanoethylene)-urea. Novel prophylactic possibilities]. Arzneimittelforschung 1975
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) authors,M. Ardenne,PG. Reitnauer [Demonstration of tumor inhibiting properties of a strongly immunostimulating low-molecular weight substance. Comparative studies with ifosfamide on the immuno-labile DS carcinosarcoma. Stimulation of the autoimmune activity for approx. 20 days by BA 1, a N-(2-cyanoethylene)-urea. Novel prophylactic possibilities]. Arzneimittelforschung 1975
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Citation	Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. A. Chauhan, H. Lofton et al. Mol. Microbiol. 2006	ahal4789	NAS	16942606	operon(functional linkage)
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2719c	ahal4789	NAS		operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Citation	The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. PC. Brooks, LF. Dawson et al. J. Bacteriol. 2006	ahal4789	NAS	16885473	operon(functional linkage)
Interaction	Transcription Rv2718c	ahal4789	NAS		operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006

TB Genome Annotation Portal