TB Genome Annotation Portal

Rv2701c (suhB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: inositol-1-monophosphatase SuhB
  • REFSEQ: extragenic suppressor protein SuhB
  • PATRIC: Inositol-1-monophosphatase (EC 3.1.3.25)
  • TUBERCULIST: Inositol-1-monophosphatase SuhB
  • NCBI: Inositol-1-monophosphatase SuhB
  • updated information (H37Rv4):
    • gene name: suhB
    • function:
    • reference:
• Type: Not Target
• Start: 3015863
• End: 3016735
• Operon:


• Trans-membrane region:
  
• Role: III.B - Chaperones/Heat shock
• GO terms:
  • GO:0052834 - inositol monophosphate phosphatase activity (Uniprot)
  • GO:0052833 - inositol monophosphate 4-phosphatase activity (Uniprot)
  • GO:0052832 - inositol monophosphate 3-phosphatase activity (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0046855 - inositol phosphate dephosphorylation (Uniprot)
  • GO:0046854 - phosphatidylinositol phosphorylation (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0008934 - inositol monophosphate 1-phosphatase activity (Uniprot)
  • GO:0007165 - signal transduction (Uniprot)
  • GO:0006021 - inositol biosynthetic process (Uniprot)
  • GO:0006020 - inositol metabolic process (Uniprot)
  • GO:0000287 - magnesium ion binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • IP[c] -> PI[c] + MI[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 2q74
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  2Q74	99%	Mycobacterium tuberculosis	Mycobacterium tuberculosis SuhB
  5DJK	45%	Mycobacterium tuberculosis	Structure of M. tuberculosis CysQ, a PAP phosphatase with PO4 and 2Ca bound
  5DJJ	45%	Mycobacterium tuberculosis	Structure of M. tuberculosis CysQ, a PAP phosphatase with PO4 and 2Mg bound
  5DJI	45%	Mycobacterium tuberculosis	Structure of M. tuberculosis CysQ, a PAP phosphatase with AMP, PO4, and 2Mg bound
  5DJH	45%	Mycobacterium tuberculosis	Structure of M. tuberculosis CysQ, a PAP phosphatase with AMP, PO4, and 3Mg bound
  5DJG	45%	Mycobacterium tuberculosis	Structure of M. tuberculosis CysQ, a PAP phosphatase with PAP, Mg, and Li bound
  5DJF	45%	Mycobacterium tuberculosis	Structure of M. tuberculosis CysQ, a PAP phosphatase - ligand-free structure
  5J16	37%	Staphylococcus aureus (strain MSSA476)	Crystal structure of Inositol monophosphate bound SaIMPase-II
  5I3S	37%	Staphylococcus aureus (strain MSSA476)	Crystal structure of Staphylococcal IMPase-II
  5DW8	37%	Staphylococcus aureus	Crystal structure of 2'AMP bound SaIMPase-II

• Links to additional information on suhB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.826 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VTRPDNEPARLRSVAENLAAEAAAFVRGRRAEVFGISRAGDGDGAVRAKSSPTDPVTVVDTDTERLLRDRLAQLRPGDPILGEEGGGPADVTATPSDRVT
WVLDPIDGTVNFVYGIPAYAVSIGAQVGGITVAGAVADVAARTVYSAATGLGAHLTDERGRHVLRCTGVDELSMALLGTGFGYSVRCREKQAELLAHVVP
LVRDVRRIGSAALDLCMVAAGRLDAYYEHGVQVWDCAAGALIAAEAGARVLLSTPRAGGAGLVVVAAAPGIADELLAALQRFNGLEPIPD

Additional Information