TB Genome Annotation Portal

Rv2623 (TB31.7)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: universal stress protein
  • REFSEQ: hypothetical protein
  • PATRIC: Universal stress protein family
  • TUBERCULIST: Universal stress protein family protein TB31.7
  • NCBI: Universal stress protein family protein TB31.7
  • updated information (H37Rv4):
    • gene name: TB31.7
    • function: regulates growth, interact with Rv1747 (ABC)
    • reference: Glass (2017) PMID: 28753640
• Type: Not Target
• Start: 2949593
• End: 2950486
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0085014 - dormancy entry of symbiont in host (Uniprot)
  • GO:0040008 - regulation of growth (Uniprot)
  • GO:0040007 - growth (Uniprot)
  • GO:0009405 - pathogenesis (Uniprot)
  • GO:0006950 - response to stress (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005829 - cytosol (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0001666 - response to hypoxia (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 2jax, 3cis
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3CIS	100%	Mycobacterium tuberculosis	The Crystal Structure of Rv2623 from Mycobacterium tuberculosis
  2JAX	100%	MYCOBACTERIUM TUBERCULOSIS	Universal Stress Protein Rv2623 from Mycobaterium Tuberculosis

• Links to additional information on TB31.7:
  • KEGG - nucleotide and amino acid sequences of gene
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.885 (from Jeremy Rock's lab)
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSSGNSSLGIIVGIDDSPAAQVAVRWAARDAELRKIPLTLVHAVSPEVATWLEVPLPPGVLRWQQDHGRHLIDDALKVVEQASLRAGPPTVHSEIVPAAA
VPTLVDMSKDAVLMVVGCLGSGRWPGRLLGSVSSGLLRHAHCPVVIIHDEDSVMPHPQQAPVLVGVDGSSASELATAIAFDEASRRNVDLVALHAWSDVD
VSEWPGIDWPATQSMAEQVLAERLAGWQERYPNVAITRVVVRDQPARQLVQRSEEAQLVVVGSRGRGGYAGMLVGSVGETVAQLARTPVIVARESLT

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.8 (0.28)	2.19 (0.96)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link