TB Genome Annotation Portal

Rv2594c (ruvC)

Amino Acid Sequence

VRVMGVDPGLTRCGLSLIESGRGRQLTALDVDVVRTPSDAALAQRLLAISDAVEHWLDTHHPEVVAIERVFSQLNVTTVMGTAQAGGVIALAAAKRGVDV
HFHTPSEVKAAVTGNGSADKAQVTAMVTKILALQAKPTPADAADALALAICHCWRAPTIARMAEATSRAEARAAQQRHAYLAKLKAAR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2594c/ruvC, gene len: 566 bp, num TA sites: 6
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBiogrowth defect7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microno data 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=0.0)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.0)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-1.38)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.36 (0.22)1.4 (0.62)
codons under selection
omega plotsomega plot across ORF for Moldova isolatesomega plot across ORF for CRyPTIC isolates
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

      • Not upregulated by other genes.
    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2594c (ruvC)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
    InteractionPhysicalInteraction Rv2973cshahanup86ISSStructural Analysis
    authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
    InteractionPhysicalInteraction Rv2973cshahanup86ISSSpectrophotometric
    authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
    InteractionPhysicalInteraction Rv2603csureshks89ISA
    authors,MY. Galperin,EV. Koonin From complete genome sequence to 'complete' understanding? Trends Biotechnol. 2010
    InteractionPhysicalInteraction Rv2603csureshks89ISA
    authors,H. Liang,L. Li,Z. Dong,MG. Surette,K. Duan The YebC family protein PA0964 negatively regulates the Pseudomonas aeruginosa quinolone signal system and pyocyanin production. J. Bacteriol. 2008
    CitationIdentification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. PC. Brooks, F. Movahedzadeh et al. J. Bacteriol. 2001shahanup86IEP11443079Co-expression (Functional linkage)
    InteractionPhysicalInteraction Rv2592cshahanup86IEPCo-expression (Functional linkage)
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    InteractionPhysicalInteraction Rv2593cshahanup86IEPCo-expression (Functional linkage)
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    CitationStructure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. JR. Prabu, S. Thamotharan et al. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006shahanup86IEP16880543Co-expression (Functional linkage)
    InteractionPhysicalInteraction Rv2592cshahanup86IEPCo-expression (Functional linkage)
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2593cshahanup86IEPCo-expression (Functional linkage)
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    CitationIdentification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. PC. Brooks, F. Movahedzadeh et al. J. Bacteriol. 2001shahanup86IEP11443079Co-expression (Functional linkage)
    InteractionPhysicalInteraction Rv2592cshahanup86IEPCo-expression (Functional linkage)
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    InteractionPhysicalInteraction Rv2593cshahanup86IEPCo-expression (Functional linkage)
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    CitationStructure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. JR. Prabu, S. Thamotharan et al. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006shahanup86IEP16880543Co-expression (Functional linkage)
    InteractionPhysicalInteraction Rv2592cshahanup86IEPCo-expression (Functional linkage)
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2593cshahanup86IEPCo-expression (Functional linkage)
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2593cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Crystallographic and modelling studies on Mycobacterium tuberculosis RuvA Additional role of RuvB-binding domain and inter species variability. Biochim. Biophys. Acta 2009
    InteractionPhysicalInteraction Rv2593cshahanup86IDAStructural Analysis
    JS. Khanduja, P. Tripathi et al. Mycobacterium tuberculosis RuvA Induces Two Distinct Types of Structural Distortions between the Homologous and Heterologous Holliday Junctions (dagger). Biochemistry 2008
    InteractionPhysicalInteraction Rv2593cshahanup86IDAStructural Analysis
    authors,CV. Privezentzev,A. Keeley,B. Sigala,IR. Tsaneva The role of RuvA octamerization for RuvAB function in vitro and in vivo. J. Biol. Chem. 2005
    InteractionPhysicalInteraction Rv2593cshahanup86IDAStructural Analysis
    JR. Prabu, S. Thamotharan et al. Structure of Mycobacterium tuberculosis RuvA, a protein involved in recombination. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2006
    InteractionPhysicalInteraction Rv2593cshahanup86IDAStructural Analysis
    PC. Brooks, F. Movahedzadeh et al. Identification of some DNA damage-inducible genes of Mycobacterium tuberculosis: apparent lack of correlation with LexA binding. J. Bacteriol. 2001
    InteractionRegulatory Rv0616cakankshajain.21IEPCo-expression (Functional linkage)
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    InteractionRegulatedBy Rv2720yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    InteractionRegulatedBy Rv0491yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
    OtherTBPWY:Recombination repairvmizrahirecA-independent DNA damage-induced
    OtherTBPWY:Recombination repairvmizrahiIncreased expression in Mtb from clinical lung samples

    Comments