Rv2431c (PE25)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: PE family protein
- REFSEQ: PE family protein
- PATRIC: PE family protein
- TUBERCULIST: PE family protein PE25
- NCBI: PE family protein PE25
- updated information (H37Rv4):
  - gene name: PE25
  - function:
  - reference:
Type: Not Target
Start: 2727967
End: 2728266
Operon:

Trans-membrane region:
Role: IV.C.1.a - PE subfamily
GO terms:
- GO:0009405 - pathogenesis (Uniprot)
- GO:0005576 - extracellular region (Uniprot)
- GO:0005515 - protein binding (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure: 2g38
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
4W4L	100%	Mycobacterium tuberculosis	Crystal structure of EspG5 in complex with PE25 and PPE41 from the ESX-5 type VII secretion system of M. tuberculosis
4W4K	100%	Mycobacterium tuberculosis	Crystal structure of a PE25-PPE41 heterodimer from a type VII secretion system of M. tuberculosis
4KXR	100%	Mycobacterium tuberculosis	Structure of the Mycobacterium tuberculosis type VII secretion system chaperone EspG5 in complex with PE25-PPE41 dimer
2G38	100%	Mycobacterium tuberculosis	A PE/PPE Protein Complex from Mycobacterium tuberculosis
5XFS	35%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis

Links to additional information on PE25:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.64 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MSFVITNPEALTVAATEVRRIRDRAIQSDAQVAPMTTAVRPPAADLVSEKAATFLVEYARKYRQTIAAAAVVLEEFAHALTTGADKYATAEADNIKTFS

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 6 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 6 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 6 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 7 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 7 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 1.46
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0081 (-) (Direct binding)
- Rv0981 (mprA) (Direct binding)
- Rv2034 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv2431c (PE25)

Property	Value	Creator	Evidence	PMID	Comment
Citation	The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. S. Tundup, N. Pathak et al. PLoS ONE 2008	singhpankaj2116	IDA	18974870	Structural Analysis
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Structural Analysis S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Spectrophotometric S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Citation	Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Proc. Natl. Acad. Sci. U.S.A. 2006	singhpankaj2116	IDA	16690741	Structural Analysis
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Structural Analysis authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Citation	Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. S. Tundup, Y. Akhter et al. FEBS Lett. 2006	singhpankaj2116	IDA	16458305	Structural Analysis
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Structural Analysis S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Citation	A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. AM. Abdallah, T. Verboom et al. Mol. Microbiol. 2006	singhpankaj2116	IDA	17076665	Structural Analysis
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Structural Analysis AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006
Citation	Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. J. Zeng, L. Zhang et al. Protein Expr. Purif. 2010	singhpankaj2116	IDA	19747546	Structural Analysis
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Structural Analysis J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Structural Analysis S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Citation	Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Proc. Natl. Acad. Sci. U.S.A. 2006	singhpankaj2116	IDA	16690741	Spectrophotometric
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Spectrophotometric authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Citation	Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. S. Tundup, Y. Akhter et al. FEBS Lett. 2006	singhpankaj2116	IDA	16458305	Spectrophotometric
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Spectrophotometric S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Citation	A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. AM. Abdallah, T. Verboom et al. Mol. Microbiol. 2006	singhpankaj2116	IDA	17076665	Spectrophotometric
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Spectrophotometric AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006
Citation	Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. J. Zeng, L. Zhang et al. Protein Expr. Purif. 2010	singhpankaj2116	IDA	19747546	Spectrophotometric
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Spectrophotometric J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010
Citation	The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. S. Tundup, N. Pathak et al. PLoS ONE 2008	singhpankaj2116	IDA	18974870	Spectrophotometric
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Structural Analysis authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Structural Analysis S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Structural Analysis AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Structural Analysis J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Spectrophotometric authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Spectrophotometric S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Spectrophotometric AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Spectrophotometric J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010
Interaction	PhysicalInteraction Rv2430c	singhpankaj2116	IDA		Spectrophotometric S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Interaction	PhysicalInteraction Rv2077c	ahal4789	IGC		Gene neighbourhood (Functional linkage) S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Interaction	PhysicalInteraction Rv2077c	sourish10	IGC		Gene neighbourhood (Functional linkage) S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008
Symbol	PPE41	jlew			PPE25 and PPE41 interact. Using an in vivo pull-down assay, for the first time we have confirmed the presence of three pairs of PE/PPE-related novel protein interactions in this pathogen. J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010
Citation	Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. J. Zeng, L. Zhang et al. Protein Expr. Purif. 2010	jlew		19747546	PPE25 and PPE41 interact. Using an in vivo pull-down assay, for the first time we have confirmed the presence of three pairs of PE/PPE-related novel protein interactions in this pathogen.
Citation	Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. S. Tundup, Y. Akhter et al. FEBS Lett. 2006	jlew		16458305	Rv2431c and Rv2430c are transcribed as an operon. These two proteins interact with each other and form oligomers when alone, however, when present together they exist as heteromer.

Property

Value

Creator

Evidence

PMID

Comment

Citation

The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. S. Tundup, N. Pathak et al. PLoS ONE 2008

singhpankaj2116

IDA

18974870

Structural Analysis

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Structural Analysis
S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Spectrophotometric
S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008

Citation

Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Proc. Natl. Acad. Sci. U.S.A. 2006

singhpankaj2116

IDA

16690741

Structural Analysis

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Structural Analysis
authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006

Citation

Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. S. Tundup, Y. Akhter et al. FEBS Lett. 2006

singhpankaj2116

IDA

16458305

Structural Analysis

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Structural Analysis
S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006

Citation

A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. AM. Abdallah, T. Verboom et al. Mol. Microbiol. 2006

singhpankaj2116

IDA

17076665

Structural Analysis

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Structural Analysis
AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006

Citation

Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. J. Zeng, L. Zhang et al. Protein Expr. Purif. 2010

singhpankaj2116

IDA

19747546

Structural Analysis

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Structural Analysis
J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Structural Analysis
S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008

Citation

singhpankaj2116

IDA

16690741

Spectrophotometric

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Spectrophotometric
authors,M. Strong,MR. Sawaya,S. Wang,M. Phillips,D. Cascio,D. Eisenberg Toward the structural genomics of complexes: crystal structure of a PE/PPE protein complex from Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2006

Citation

singhpankaj2116

IDA

16458305

Spectrophotometric

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Spectrophotometric
S. Tundup, Y. Akhter et al. Clusters of PE and PPE genes of Mycobacterium tuberculosis are organized in operons: evidence that PE Rv2431c is co-transcribed with PPE Rv2430c and their gene products interact with each other. FEBS Lett. 2006

Citation

A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. AM. Abdallah, T. Verboom et al. Mol. Microbiol. 2006

singhpankaj2116

IDA

17076665

Spectrophotometric

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Spectrophotometric
AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006

Citation

Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. J. Zeng, L. Zhang et al. Protein Expr. Purif. 2010

singhpankaj2116

IDA

19747546

Spectrophotometric

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Spectrophotometric
J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010

Citation

The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. S. Tundup, N. Pathak et al. PLoS ONE 2008

singhpankaj2116

IDA

18974870

Spectrophotometric

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Structural Analysis
AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Structural Analysis
J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Spectrophotometric
AM. Abdallah, T. Verboom et al. A specific secretion system mediates PPE41 transport in pathogenic mycobacteria. Mol. Microbiol. 2006

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Spectrophotometric
J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010

Interaction

PhysicalInteraction Rv2430c

singhpankaj2116

IDA

Spectrophotometric
S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008

Interaction

PhysicalInteraction Rv2077c

ahal4789

IGC

Gene neighbourhood (Functional linkage)
S. Tundup, N. Pathak et al. The co-operonic PE25/PPE41 protein complex of Mycobacterium tuberculosis elicits increased humoral and cell mediated immune response. PLoS ONE 2008

Interaction

PhysicalInteraction Rv2077c

sourish10

IGC

Symbol

PPE41

jlew

PPE25 and PPE41 interact. Using an in vivo pull-down assay, for the first time we have confirmed the presence of three pairs of PE/PPE-related novel protein interactions in this pathogen.
J. Zeng, L. Zhang et al. Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. Protein Expr. Purif. 2010

Citation

Over-producing soluble protein complex and validating protein-protein interaction through a new bacterial co-expression system. J. Zeng, L. Zhang et al. Protein Expr. Purif. 2010

jlew

19747546

PPE25 and PPE41 interact. Using an in vivo pull-down assay, for the first time we have confirmed the presence of three pairs of PE/PPE-related novel protein interactions in this pathogen.

Citation

jlew

16458305

Rv2431c and Rv2430c are transcribed as an operon. These two proteins interact with each other and form oligomers when alone, however, when present together they exist as heteromer.

Comments