TB Genome Annotation Portal

Rv2398c (cysW)

Amino Acid Sequence

MTSLPAARYLVRSVALGYVFVLLIVPVALILWRTFEPGFGQFYAWISTPAAISALNLSLLVVAIVVPLNVIFGVTTALVLARNRFRGKGVLQAIIDLPFA
VSPVIVGVSLILLWGSAGALGFVEQDLGFKIIFGLPGIVLGSMFVTCPFVVREVEPVLHELGTDQEQAAATLGSGWWQTFWRITLPSIRWGLTYGIVLTV
ARTLGEYGAVIIVSSNLPGTSQTLTLLVSDRYHRGAEYGAYALSTLLMAVSVVVLIVQMVLDARRARAVSEG
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2398c/cysW, gene len: 818 bp, num TA sites: 18
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBiogrowth defect7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-2.51)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifeessential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifeessentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.0)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysYES (LFC=4.98)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.3 (0.67)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2398c/cysWRv3223c/sigH2.32
    Rv2398c/cysWRv3058c/-1.33
    Rv2398c/cysWRv1816/-1.06
    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:

      • Not downregulated by other genes.


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2398c (cysW)

    PropertyValueCreatorEvidencePMIDComment
    CitationFunctional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. E. Wooff, SL. Michell et al. Mol. Microbiol. 2002njamshidiIDA11929522PMID: 11929522
    TermTBRXN:SULabc sulfate transport via ABC system - IDAnjamshidiIDA11929522PMID: 11929522
    E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
    CitationFunctional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. E. Wooff, SL. Michell et al. Mol. Microbiol. 2002njamshidiISS11929522PMID: 11929522
    TermTBRXN:SULabc sulfate transport via ABC system - ISSnjamshidiISS11929522PMID: 11929522
    E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
    InteractionPhysicalInteraction Rv2400ckholia.truptiRCAGene neighbourhood (Functional linkage)
    authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
    InteractionPhysicalInteraction Rv2399ckholia.truptiRCAGene neighbourhood (Functional linkage)
    authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
    CitationInvestigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. authors,N. Jamshidi,B. Palsson BMC Syst Biol 2007kholia.truptiRCA17555602Gene neighbourhood (Functional linkage)
    InteractionPhysicalInteraction Rv2397ckholia.truptiRCAGene neighbourhood (Functional linkage)
    authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
    InteractionPhysicalInteraction Rv2399ckholia.truptiRCAGene neighbourhood (Functional linkage)
    authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
    InteractionPhysicalInteraction Rv2400ckholia.truptiRCAGene neighbourhood (Functional linkage)
    authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
    InteractionPhysicalInteraction Rv1739ckholia.truptiRCAGene neighbourhood (Functional linkage)
    authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
    InteractionPhysicalInteraction Rv2397ckholia.truptiRCAGene neighbourhood (Functional linkage)
    authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
    InteractionPhysicalInteraction Rv1739cshahanup86NAS
    authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
    InteractionPhysicalInteraction Rv1739cvashishtrvNAS
    authors,N. Jamshidi,B. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
    CitationFunctional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. E. Wooff, SL. Michell et al. Mol. Microbiol. 2002jjmcfadden11929522Inferred from direct assay
    OtherEC:jjmcfaddenInferred from direct assay
    E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002

    Comments