TB Genome Annotation Portal

Rv2394 (ggtB)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: gamma-glutamyltransferase
  • REFSEQ: gamma-glutamyltranspeptidase precursor GgtB
  • PATRIC: Gamma-glutamyltranspeptidase (EC 2.3.2.2)
  • TUBERCULIST: Probable gamma-glutamyltranspeptidase precursor GgtB (gamma-glutamyltransferase) (glutamyl transpeptidase)
  • NCBI: Probable gamma-glutamyltranspeptidase precursor GgtB (gamma-glutamyltransferase) (glutamyl transpeptidase)
  • updated information (H37Rv4):
    • gene name: ggtB
    • function:
    • reference:
• Type: Not Target
• Start: 2688010
• End: 2689941
• Operon:


• Trans-membrane region:
  
• Role: I.G.10 - Thioredoxin, glutaredoxin and mycothiol
• GO terms:
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ALA[c] + GTHRD[c] -> CGLY[c] + GLUALA[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5Y9B	40%	Bacillus licheniformis	Crystal structure of Bacillus licheniformis Gamma glutamyl transpeptidase with DON
  5Y8X	40%	Bacillus licheniformis	Crystal structure of Bacillus licheniformis Gamma glutamyl transpeptidase with Azaserine
  5XLU	40%	Bacillus licheniformis	High Resolution Crystal Structure of Bacillus Licheniformis Gamma Glutamyl Transpeptidase with Acivicin
  4OTU	40%	Bacillus licheniformis	Crystal structure of the gamma-glutamyltranspeptidase from Bacillus licheniformis in complex with L-Glutamate
  4OTT	40%	Bacillus licheniformis	Crystal structure of the gamma-glutamyltranspeptidase from Bacillus licheniformis.
  5BPK	39%	Helicobacter pylori 26695	Varying binding modes of inhibitors and structural differences in the binding pockets of different gamma-glutamyltranspeptidases
  3FNM	39%	Helicobacter pylori	Crystal structure of acivicin-inhibited gamma-glutamyltranspeptidase reveals critical roles for its C-terminus in autoprocessing and catalysis
  2QM6	39%	Helicobacter pylori	Crystal Structure of Helicobacter Pylori Gamma-Glutamyltranspeptidase in Complex with Glutamate
  2NQO	39%	Helicobacter pylori	Crystal Structure of Helicobacter pylori gamma-Glutamyltranspeptidase
  2QMC	39%	Helicobacter pylori	Crystal Structure of Helicobacter Pylori Gamma-Glutamyltranspeptidase T380A Mutant

• Links to additional information on ggtB:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.48 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VSVWLRAGALVAAVMLSLSGCGGFHAGAPSTAGPCEIVPNGTPAPKTPPATVPSSRNLATNPEIATGYRRDMTVVRTAHYAAATANPLATQVACRVLRDG
GTAADAVVAAQAVLGLVEPQSSGIGGGGYLVYFDARTGSVQAYDGREVAPAAATENYLRWVSDVDRSAPRPNARASGRSIGVPGILRMLEMVHNEHGRTP
WRDLFGPAVTLADGGFDISARMGAAISDAAPQLRDDPEARKYFLNPDGSPKPAGTRLTNPAYSKTLSAIASAGANAFYSGDIAHDIVAAASDTSNGRTPG
LLTIEDLAGYLAKRRQPLCTTYRGREICGMPSSGGVAVAATLGILEHFPMSDYAPSKVDLNGGRPTVMGVHLIAEAERLAYADRDQYIADVDFVRLPGGS
LTTLVDPGYLAARAALISPQHSMGSARPGDFGAPTAVAPPVPEHGTSHLSVVDSYGNAATLTTTVESSFGSYHLVDGFILNNQLSDFSAEPHATDGSPVA
NRVEPGKRPRSSMAPTLVFDHSSAGRGALYAVLGSPGGSMIIQFVVKTLVAMLDWGLNPQQAVSLVDFGAANSPHTNLGGENPEINTSDDGDHDPLVQGL
RALGHRVNLAEQSSGLSAITRSEAGWAGGADPRREGAVMGDDA

Additional Information