TB Genome Annotation Portal

Rv2386c (mbtI)

Amino Acid Sequence

VSELSVATGAVSTASSSIPMPAGVNPADLAAELAAVVTESVDEDYLLYECDGQWVLAAGVQAMVELDSDELRVIRDGVTRRQQWSGRPGAALGEAVDRLL
LETDQAFGWVAFEFGVHRYGLQQRLAPHTPLARVFSPRTRIMVSEKEIRLFDAGIRHREAIDRLLATGVREVPQSRSVDVSDDPSGFRRRVAVAVDEIAA
GRYHKVILSRCVEVPFAIDFPLTYRLGRRHNTPVRSFLLQLGGIRALGYSPELVTAVRADGVVITEPLAGTRALGRGPAIDRLARDDLESNSKEIVEHAI
SVRSSLEEITDIAEPGSAAVIDFMTVRERGSVQHLGSTIRARLDPSSDRMAALEALFPAVTASGIPKAAGVEAIFRLDECPRGLYSGAVVMLSADGGLDA
ALTLRAAYQVGGRTWLRAGAGIIEESEPEREFEETCEKLSTLTPYLVARQ
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2386c/mbtI, gene len: 1352 bp, num TA sites: 19
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBiogrowth defect7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathessentialM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-1.89)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifegrowth defect7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifegrowth defectBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.055)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysessentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysessentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-0.22)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.05 (0.41)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2386c/mbtIRv2175c/-3.56
    Rv2386c/mbtIRv0445c/sigK3.39
    Rv2386c/mbtIRv0047c/napM2.22
    Rv2386c/mbtIRv3133c/dosR/devR2.15
    Rv2386c/mbtIRv3765c/tcrX1.91
    Rv2386c/mbtIRv1379/pyrR1.86
    Rv2386c/mbtIRv0330c/-1.61
    Rv2386c/mbtIRv3416/whiB3-1.22


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2386c (mbtI)

    PropertyValueCreatorEvidencePMIDComment
    CitationIdentification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. LE. Quadri, J. Sello et al. Chem. Biol. 1998njamshidiIPI10419938|9831524|12657046This step is needed for the biosynthesis of mycoabctin which is needed for Fe acquisition. Stoichiometry and reaction are inferred - no solid evidence for it yet. see PMID: 9831524, 10419938, 12657046
    TermTBRXN:SALCS salicylate synthase - IPInjamshidiIPI10419938|9831524|12657046This step is needed for the biosynthesis of mycoabctin which is needed for Fe acquisition. Stoichiometry and reaction are inferred - no solid evidence for it yet. see PMID: 9831524, 10419938, 12657046
    LE. Quadri, J. Sello et al. Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. Chem. Biol. 1998
    CitationIron acquisition and metabolism by mycobacteria. authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry J. Bacteriol. 1999njamshidiIPI10419938|9831524|12657046This step is needed for the biosynthesis of mycoabctin which is needed for Fe acquisition. Stoichiometry and reaction are inferred - no solid evidence for it yet. see PMID: 9831524, 10419938, 12657046
    TermTBRXN:SALCS salicylate synthase - IPInjamshidiIPI10419938|9831524|12657046This step is needed for the biosynthesis of mycoabctin which is needed for Fe acquisition. Stoichiometry and reaction are inferred - no solid evidence for it yet. see PMID: 9831524, 10419938, 12657046
    authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry Iron acquisition and metabolism by mycobacteria. J. Bacteriol. 1999
    CitationGenes required for mycobacterial growth defined by high density mutagenesis. authors,CM. Sassetti,DH. Boyd,EJ. Rubin Mol. Microbiol. 2003njamshidiIPI12657046|9831524|10419938This step is needed for the biosynthesis of mycoabctin which is needed for Fe acquisition. Stoichiometry and reaction are inferred - no solid evidence for it yet. see PMID: 9831524, 10419938, 12657046
    TermTBRXN:SALCS salicylate synthase - IPInjamshidiIPI10419938|9831524|12657046This step is needed for the biosynthesis of mycoabctin which is needed for Fe acquisition. Stoichiometry and reaction are inferred - no solid evidence for it yet. see PMID: 9831524, 10419938, 12657046
    authors,CM. Sassetti,DH. Boyd,EJ. Rubin Genes required for mycobacterial growth defined by high density mutagenesis. Mol. Microbiol. 2003
    CitationideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. GM. Rodriguez, MI. Voskuil et al. Infect. Immun. 2002priyadarshinipriyanka2001IEP12065475Co-expression (Functional linkage)
    InteractionRegulatory Rv2711priyadarshinipriyanka2001IEPCo-expression (Functional linkage)
    GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
    CitationIron acquisition and metabolism by mycobacteria. authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry J. Bacteriol. 1999priyadarshinipriyanka2001IEP10419938Co-expression (Functional linkage)
    InteractionRegulatory Rv2711priyadarshinipriyanka2001IEPCo-expression (Functional linkage)
    authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry Iron acquisition and metabolism by mycobacteria. J. Bacteriol. 1999
    CitationIdentification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. LE. Quadri, J. Sello et al. Chem. Biol. 1998priyadarshinipriyanka2001IEP9831524Co-expression (Functional linkage)
    InteractionRegulatory Rv2711priyadarshinipriyanka2001IEPCo-expression (Functional linkage)
    LE. Quadri, J. Sello et al. Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. Chem. Biol. 1998
    InteractionRegulatedBy Rv2711yamir.morenoTASLiterature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
    G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
    CitationThe structure of MbtI from Mycobacterium tuberculosis, the first enzyme in the biosynthesis of the siderophore mycobactin, reveals it to be a salicylate synthase. AJ. Harrison, M. Yu et al. J. Bacteriol. 2006extern:JZUCKER16923875Assay of protein purified to homogeneity from its native host
    TermEC:5.4.4.2 Isochorismate synthase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from its native host
    AJ. Harrison, M. Yu et al. The structure of MbtI from Mycobacterium tuberculosis, the first enzyme in the biosynthesis of the siderophore mycobactin, reveals it to be a salicylate synthase. J. Bacteriol. 2006
    TermEC:4.1.3.27 Anthranilate synthase. - NRextern:JZUCKERNRAssay of protein purified to homogeneity from its native host
    AJ. Harrison, M. Yu et al. The structure of MbtI from Mycobacterium tuberculosis, the first enzyme in the biosynthesis of the siderophore mycobactin, reveals it to be a salicylate synthase. J. Bacteriol. 2006
    OtherEC:4.2.99.21extern:JZUCKERAssay of protein purified to homogeneity from its native host
    AJ. Harrison, M. Yu et al. The structure of MbtI from Mycobacterium tuberculosis, the first enzyme in the biosynthesis of the siderophore mycobactin, reveals it to be a salicylate synthase. J. Bacteriol. 2006

    Comments