TB Genome Annotation Portal

Rv2378c (mbtG)

Amino Acid Sequence

MNPTLAVLGAGAKAVAVAAKASVLRDMGVDVPDVIAVERIGVGANWQASGGWTDGAHRLGTSPEKDVGFPYRSALVPRRNAELDERMTRYSWQSYLIATA
SFAEWIDRGRPAPTHRRWSQYLAWVADHIGLKVIHGEVERLAVTGDRWALCTHETTVQADALMITGPGQAEKSLLPGNPRVLSIAQFWDRAAGHDRINAE
RVAVIGGGETAASMLNELFRHRVSTITVISPQVTLFTRGEGFFENSLFSDPTDWAALTFDERRDALARTDRGVFSATVQEALLADDRIHHLRGRVAHAVG
RQGQIRLTLSTNRGSENFETVHGFDLVIDGSGADPLWFTSLFSQHTLDLLELGLGGPLTADRLQEAIGYDLAVTDVTPKLFLPTLSGLTQGPGFPNLSCL
GLLSDRVLGAGIFTPTKHNDTRRSGEHQSFR
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv2378c/mbtG, gene len: 1295 bp, num TA sites: 9
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASno data BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathnon-essentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathuncertainM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-1.09)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.01)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.2)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

global set of 10,626 Mtb clinical isolates
under significant positive selection?NO
omega peak height (95%CI lower bound)1.91 (0.43)
codons under selection
omega plotsomega plot across ORF
genetic variants*link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: see table of TFOE interactions below

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    TFOE = Transcription Factor Over-Expression study
    significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01

    genedysregulated by OE ofLFC
    Rv2378c/mbtGRv3286c/sigF2.52
    Rv2378c/mbtGRv2175c/-2.03
    Rv2378c/mbtGRv0445c/sigK1.81
    Rv2378c/mbtGRv0047c/napM1.18
    Rv2378c/mbtGRv0023/--1.4


    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv2378c (mbtG)

    PropertyValueCreatorEvidencePMIDComment
    TermEC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDAnjamshidiIDA7761471|For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. Proc. Natl. Acad. Sci. U.S.A. 1995
    TermTBRXN:MCBTS3 carboxymycobactin synthesis - IDAnjamshidiIDA7761471|For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. Proc. Natl. Acad. Sci. U.S.A. 1995
    CitationIron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004njamshidiIDA7761471||14670352For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    TermEC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDAnjamshidiIDA7761471|For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    TermTBRXN:MCBTS3 carboxymycobactin synthesis - IDAnjamshidiIDA7761471|For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    CitationIron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Proc. Natl. Acad. Sci. U.S.A. 1995njamshidiIDA7761471|For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
    CitationIron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004njamshidiISS14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    TermEC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - ISSnjamshidiISS14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    TermTBRXN:MCBTS2 mycobactin synthesis - ISSnjamshidiISS14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    CitationIron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004njamshidiIPI14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    TermEC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IPInjamshidiIPI14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    TermTBRXN:MCBTS2 mycobactin synthesis - IPInjamshidiIPI14670352See PMID: 14670352. Mycobactin T is commonly found in Mtb
    authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
    CitationideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. GM. Rodriguez, MI. Voskuil et al. Infect. Immun. 2002priyadarshinipriyanka2001IEP12065475Co-expression (Functional linkage)
    InteractionRegulatory Rv2711priyadarshinipriyanka2001IEPCo-expression (Functional linkage)
    GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
    CitationIron acquisition and metabolism by mycobacteria. authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry J. Bacteriol. 1999priyadarshinipriyanka2001IEP10419938Co-expression (Functional linkage)
    InteractionRegulatory Rv2711priyadarshinipriyanka2001IEPCo-expression (Functional linkage)
    authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry Iron acquisition and metabolism by mycobacteria. J. Bacteriol. 1999
    CitationIdentification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. LE. Quadri, J. Sello et al. Chem. Biol. 1998priyadarshinipriyanka2001IEP9831524Co-expression (Functional linkage)
    InteractionRegulatory Rv2711priyadarshinipriyanka2001IEPCo-expression (Functional linkage)
    LE. Quadri, J. Sello et al. Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. Chem. Biol. 1998
    InteractionRegulatedBy Rv2711yamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
    GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002

    Comments