Rv2378c (mbtG)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: L-lysine 6-monooxygenase mbtG
- REFSEQ: lysine-N-oxygenase MBTG (L-lysine 6-monooxygenase) (lysine N6-hydroxylase)
- PATRIC: L-lysine 6-monooxygenase MbtG (EC 1.14.13.59)
- TUBERCULIST: Lysine-N-oxygenase MbtG (L-lysine 6-monooxygenase) (lysine N6-hydroxylase)
- NCBI: Lysine-N-oxygenase MbtG (L-lysine 6-monooxygenase) (lysine N6-hydroxylase)
- updated information (H37Rv4):
  - gene name: mbtG
  - function:
  - reference:
Type: Not Target
Start: 2656408
End: 2657703
Operon:

Trans-membrane region:
Role: I.I - Polyketide and non-ribosomal peptide synthesis
GO terms:
- GO:0055114 - oxidation-reduction process (Uniprot)
- GO:0047091 - L-lysine 6-monooxygenase (NADPH) activity (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0019540 - siderophore biosynthetic process from catechol (Uniprot)
- GO:0016491 - oxidoreductase activity (Uniprot)
- GO:0004497 - monooxygenase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

4D7E 56% NOCARDIA FARCINICA IFM 10152 An unprecedented NADPH domain conformation in Lysine Monooxygenase NbtG from Nocardia farcinica
Links to additional information on mbtG:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.619 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
4D7E	56%	NOCARDIA FARCINICA IFM 10152	An unprecedented NADPH domain conformation in Lysine Monooxygenase NbtG from Nocardia farcinica

Amino Acid Sequence

MNPTLAVLGAGAKAVAVAAKASVLRDMGVDVPDVIAVERIGVGANWQASGGWTDGAHRLGTSPEKDVGFPYRSALVPRRNAELDERMTRYSWQSYLIATA
SFAEWIDRGRPAPTHRRWSQYLAWVADHIGLKVIHGEVERLAVTGDRWALCTHETTVQADALMITGPGQAEKSLLPGNPRVLSIAQFWDRAAGHDRINAE
RVAVIGGGETAASMLNELFRHRVSTITVISPQVTLFTRGEGFFENSLFSDPTDWAALTFDERRDALARTDRGVFSATVQEALLADDRIHHLRGRVAHAVG
RQGQIRLTLSTNRGSENFETVHGFDLVIDGSGADPLWFTSLFSQHTLDLLELGLGGPLTADRLQEAIGYDLAVTDVTPKLFLPTLSGLTQGPGFPNLSCL
GLLSDRVLGAGIFTPTKHNDTRRSGEHQSFR

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 4 non-insertions in a row out of 9 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 9 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 9 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 9 sites
Uncertain	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.480400; 4 non-insertions in a row out of 9 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.19
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0135c (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0023 (-)

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv2378c (mbtG)

Property	Value	Creator	Evidence	PMID	Comment
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDA	njamshidi	IDA	7761471\|	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. Proc. Natl. Acad. Sci. U.S.A. 1995
Term	TBRXN:MCBTS3 carboxymycobactin synthesis - IDA	njamshidi	IDA	7761471\|	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. Proc. Natl. Acad. Sci. U.S.A. 1995
Citation	Iron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004	njamshidi	IDA	7761471\|\|14670352	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDA	njamshidi	IDA	7761471\|	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	TBRXN:MCBTS3 carboxymycobactin synthesis - IDA	njamshidi	IDA	7761471\|	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Citation	Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Proc. Natl. Acad. Sci. U.S.A. 1995	njamshidi	IDA	7761471\|	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
Citation	Iron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004	njamshidi	ISS	14670352	See PMID: 14670352. Mycobactin T is commonly found in Mtb
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - ISS	njamshidi	ISS	14670352	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	TBRXN:MCBTS2 mycobactin synthesis - ISS	njamshidi	ISS	14670352	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Citation	Iron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004	njamshidi	IPI	14670352	See PMID: 14670352. Mycobactin T is commonly found in Mtb
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IPI	njamshidi	IPI	14670352	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	TBRXN:MCBTS2 mycobactin synthesis - IPI	njamshidi	IPI	14670352	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Citation	ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. GM. Rodriguez, MI. Voskuil et al. Infect. Immun. 2002	priyadarshinipriyanka2001	IEP	12065475	Co-expression (Functional linkage)
Interaction	Regulatory Rv2711	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Citation	Iron acquisition and metabolism by mycobacteria. authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry J. Bacteriol. 1999	priyadarshinipriyanka2001	IEP	10419938	Co-expression (Functional linkage)
Interaction	Regulatory Rv2711	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry Iron acquisition and metabolism by mycobacteria. J. Bacteriol. 1999
Citation	Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. LE. Quadri, J. Sello et al. Chem. Biol. 1998	priyadarshinipriyanka2001	IEP	9831524	Co-expression (Functional linkage)
Interaction	Regulatory Rv2711	priyadarshinipriyanka2001	IEP		Co-expression (Functional linkage) LE. Quadri, J. Sello et al. Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. Chem. Biol. 1998
Interaction	RegulatedBy Rv2711	yamir.moreno	IEP		Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002

Property

Value

Creator

Evidence

PMID

Comment

Term

EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDA

njamshidi

IDA

7761471|

For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. Proc. Natl. Acad. Sci. U.S.A. 1995

Term

TBRXN:MCBTS3 carboxymycobactin synthesis - IDA

njamshidi

IDA

7761471|

Citation

Iron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004

njamshidi

IDA

7761471||14670352

Term

EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDA

njamshidi

IDA

7761471|

For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004

Term

TBRXN:MCBTS3 carboxymycobactin synthesis - IDA

njamshidi

IDA

7761471|

For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb
authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004

Citation

Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Proc. Natl. Acad. Sci. U.S.A. 1995

njamshidi

IDA

7761471|

Citation

Iron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004

njamshidi

ISS

14670352

See PMID: 14670352. Mycobactin T is commonly found in Mtb

Term

EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - ISS

njamshidi

ISS

14670352

See PMID: 14670352. Mycobactin T is commonly found in Mtb
authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004

Term

TBRXN:MCBTS2 mycobactin synthesis - ISS

njamshidi

ISS

14670352

See PMID: 14670352. Mycobactin T is commonly found in Mtb
authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004

Citation

Iron, mycobacteria and tuberculosis. authors,C. Ratledge Tuberculosis (Edinb) 2004

njamshidi

IPI

14670352

See PMID: 14670352. Mycobactin T is commonly found in Mtb

Term

EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IPI

njamshidi

IPI

14670352

See PMID: 14670352. Mycobactin T is commonly found in Mtb
authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004

Term

TBRXN:MCBTS2 mycobactin synthesis - IPI

njamshidi

IPI

14670352

See PMID: 14670352. Mycobactin T is commonly found in Mtb
authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004

Citation

ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. GM. Rodriguez, MI. Voskuil et al. Infect. Immun. 2002

priyadarshinipriyanka2001

IEP

12065475

Co-expression (Functional linkage)

Interaction

Regulatory Rv2711

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002

Citation

Iron acquisition and metabolism by mycobacteria. authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry J. Bacteriol. 1999

priyadarshinipriyanka2001

IEP

10419938

Co-expression (Functional linkage)

Interaction

Regulatory Rv2711

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry Iron acquisition and metabolism by mycobacteria. J. Bacteriol. 1999

Citation

Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. LE. Quadri, J. Sello et al. Chem. Biol. 1998

priyadarshinipriyanka2001

IEP

9831524

Co-expression (Functional linkage)

Interaction

Regulatory Rv2711

priyadarshinipriyanka2001

IEP

Co-expression (Functional linkage)
LE. Quadri, J. Sello et al. Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. Chem. Biol. 1998

Interaction

RegulatedBy Rv2711

yamir.moreno

IEP

Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments..
GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002

Comments