TB Genome Annotation Portal

Rv2252 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: diacylglycerol kinase
  • REFSEQ: diacylglycerol kinase
  • PATRIC: Diacylglycerol kinase-related protein
  • TUBERCULIST: Diacylglycerol kinase
  • NCBI: Diacylglycerol kinase
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 2526989
• End: 2527918
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0016740 - transferase activity (Uniprot)
  • GO:0016310 - phosphorylation (Uniprot)
  • GO:0016301 - kinase activity (Uniprot)
  • GO:0009247 - glycolipid biosynthetic process (Uniprot)
  • GO:0008654 - phospholipid biosynthetic process (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0006629 - lipid metabolic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005524 - ATP binding (Uniprot)
  • GO:0004143 - diacylglycerol kinase activity (Uniprot)
  • GO:0003951 - NAD+ kinase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on Rv2252:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.952 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSAGQLRRHEIGKVTALTNPLSGHGAAVKAAHGAIARLKHRGVDVVEIVGGDAHDARHLLAAAVAKGTDAVMVTGGDGVVSNALQVLAGTDIPLGIIPAG
TGNDHAREFGLPTKNPKAAADIVVDGWTETIDLGRIQDDNGIEKWFGTVAATGFDSLVNDRANRMRWPHGRMRYYIAMLAELSRLRPLPFRLVLDGTEEI
VADLTLADFGNTRSYGGGLLICPNADHSDGLLDITMAQSDSRTKLLRLFPTIFKGAHVELDEVSTTRAKTVHVECPGINVYADGDFACPLPAEISAVPAA
LQVLRPRHG

Additional Information