TB Genome Annotation Portal

Rv2241 (aceE)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: pyruvate dehydrogenase E1 component
  • REFSEQ: pyruvate dehydrogenase subunit E1
  • PATRIC: Pyruvate dehydrogenase E1 component (EC 1.2.4.1)
  • TUBERCULIST: Pyruvate dehydrogenase E1 component AceE (pyruvate decarboxylase) (pyruvate dehydrogenase) (pyruvic dehydrogenase)
  • NCBI: Pyruvate dehydrogenase E1 component AceE (pyruvate decarboxylase) (pyruvate dehydrogenase) (pyruvic dehydrogenase)
  • updated information (H37Rv4):
    • gene name: aceE
    • function:
    • reference:
• Type: Not Target
• Start: 2512539
• End: 2515244
• Operon:


• Trans-membrane region:
  
• Role: I.B.2 - Pyruvate dehydrogenase
• GO terms:
  • GO:0055114 - oxidation-reduction process (Uniprot)
  • GO:0045254 - pyruvate dehydrogenase complex (Uniprot)
  • GO:0016491 - oxidoreductase activity (Uniprot)
  • GO:0008152 - metabolic process (Uniprot)
  • GO:0006096 - glycolytic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005618 - cell wall (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0004739 - pyruvate dehydrogenase (acetyl-transferring) activity (Uniprot)
  • GO:0003824 - catalytic activity (Uniprot)
  • GO:0000287 - magnesium ion binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • PYR[c] + LIPO[c] + 0.001 THI[c] -> CO2[c] + ADLIPO[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4QOY	52%	Escherichia coli	Novel binding motif and new flexibility revealed by structural analysis of a pyruvate dehydrogenase-dihydrolipoyl acetyltransferase sub-complex from the escherichia coli pyruvate dehydrogenase multi-enzyme complex
  2IEA	52%	Escherichia coli	E. coli pyruvate dehydrogenase
  2G67	52%	Escherichia coli	E. Coli Pyruvate Dehydrogenase E1 Component (Apoenzyme)
  2G28	52%	Escherichia coli	E. Coli Pyruvate Dehydrogenase H407A variant Phosphonolactylthiamin Diphosphate Complex
  2G25	52%	Escherichia coli	E. Coli Pyruvate Dehydrogenase Phosphonolactylthiamin Diphosphate Complex
  1RP7	52%	Escherichia coli	E. COLI PYRUVATE DEHYDROGENASE INHIBITOR COMPLEX
  1L8A	52%	Escherichia coli	E. COLI PYRUVATE DEHYDROGENASE
  3LQ4	52%	Escherichia coli	E. coli pyruvate dehydrogenase complex E1 E235A mutant with high TDP concentration
  3LQ2	52%	Escherichia coli	E. coli pyruvate dehydrogenase complex E1 E235A mutant with low TDP concentration
  3LPL	52%	Escherichia coli	E. coli pyruvate dehydrogenase complex E1 component E571A mutant

• Links to additional information on aceE:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -1.054 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VASYLPDIDPEETSEWLESFDTLLQRCGPSRARYLMLRLLERAGEQRVAIPALTSTDYVNTIPTELEPWFPGDEDVERRYRAWIRWNAAIMVHRAQRPGV
GVGGHISTYASSAALYEVGFNHFFRGKSHPGGGDQVFIQGHASPGIYARAFLEGRLTAEQLDGFRQEHSHVGGGLPSYPHPRLMPDFWEFPTVSMGLGPL
NAIYQARFNHYLHDRGIKDTSDQHVWCFLGDGEMDEPESRGLAHVGALEGLDNLTFVINCNLQRLDGPVRGNGKIIQELESFFRGAGWNVIKVVWGREWD
ALLHADRDGALVNLMNTTPDGDYQTYKANDGGYVRDHFFGRDPRTKALVENMSDQDIWNLKRGGHDYRKVYAAYRAAVDHKGQPTVILAKTIKGYALGKH
FEGRNATHQMKKLTLEDLKEFRDTQRIPVSDAQLEENPYLPPYYHPGLNAPEIRYMLDRRRALGGFVPERRTKSKALTLPGRDIYAPLKKGSGHQEVATT
MATVRTFKEVLRDKQIGPRIVPIIPDEARTFGMDSWFPSLKIYNRNGQLYTAVDADLMLAYKESEVGQILHEGINEAGSVGSFIAAGTSYATHNEPMIPI
YIFYSMFGFQRTGDSFWAAADQMARGFVLGATAGRTTLTGEGLQHADGHSLLLAATNPAVVAYDPAFAYEIAYIVESGLARMCGENPENIFFYITVYNEP
YVQPPEPENFDPEGVLRGIYRYHAATEQRTNKAQILASGVAMPAALRAAQMLAAEWDVAADVWSVTSWGELNRDGVAIETEKLRHPDRPAGVPYVTRALE
NARGPVIAVSDWMRAVPEQIRPWVPGTYLTLGTDGFGFSDTRPAARRYFNTDAESQVVAVLEALAGDGEIDPSVPVAAARQYRIDDVAAAPEQTTDPGPG
A

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

• Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
  • Moldova: 2,057 clinical isolates
  • global set: 5,195 clinical isolates from 15 other countries
• In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
• A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	2.46 (0.64)	1.26 (0.68)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link