Rv2181 (-)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: alpha-12-mannosyltransferase
REFSEQ: integral membrane protein
PATRIC: Possible membrane protein
TUBERCULIST: Alpha(1->2)mannosyltransferase
NCBI: Alpha(1->2)mannosyltransferase
updated information (H37Rv4):
gene name: mptC
function:
reference: Mishra (2011) Rv2181
Coordinates in H37Rv: 2443302 - 2444585
Gene length: 1284 bp (with stop codon), 427 aa (without stop codon)
Operon:
Trans-membrane region:
Role: II.C.5 - Other membrane proteins
GO terms:
GO:0097502 - mannosylation (Uniprot)
GO:0046488 - phosphatidylinositol metabolic process (Uniprot)
GO:0016758 - transferase activity, transferring hexosyl groups (Uniprot)
GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
GO:0016740 - transferase activity (Uniprot)
GO:0016021 - integral component of membrane (Uniprot)
GO:0016020 - membrane (Uniprot)
GO:0009405 - pathogenesis (Uniprot)
GO:0009247 - glycolipid biosynthetic process (Uniprot)
GO:0008654 - phospholipid biosynthetic process (Uniprot)
GO:0006629 - lipid metabolic process (Uniprot)
GO:0005886 - plasma membrane (Uniprot)
GO:0000026 - alpha-1,2-mannosyltransferase activity (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): (none with >35% aa id)
Links to additional information on Rv2181:
Amino Acid Sequence
MSAWRAPEVGSRLGRRVLWCLLWLLAGVALGYVAWRLFGHTPYRIDIDIYQMGARAWLDGRPLYGGGVLFHTPIGLNLPFTYPPLAAVLFSPFAWLQMPA
ASVAITVLTLVLLIASTAIVLTGLDAWPTSRLVPAPARLRRLWLAVLIVAPATIWLEPISSNFAFGQINVVLMTLVIVDCFPRRTPWPRGLMLGLGIALK
LTPAVFLLYFLLRRDGRAALTALASFAVATLLGFVLAWRDSWEYWTHTLHHTDRIGAAALNTDQNIAGALARLTIGDDERFALWVAGSLLVLAATIWAMR
RVLRAGEPTLAVICVALFGLVVSPVSWSHHWVWMLPAVLVIGLLGWRRRNVALAMLSLAGVVLMRWTPIDLLPQHRETTAVWWRQLAGMSYVWWALAVIV
VAGLTVTARMTPQRSLTRGLTPAPTAS
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv2181/-,
gene len: 1283 bp, num TA sites: 20
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio growth advantage 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS non-essential BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-0.52) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife YES (LFC=-0.723) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=-0.47) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv2181: 0.61252672
lineage-specific pN/pS in L1: 0.689277651
lineage-specific pN/pS in L2: 0.657836916
lineage-specific pN/pS in L3: 0.489461991
lineage-specific pN/pS in L4: 0.595244224
Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods )
Moldova: 2,057 clinical isolates
global set: 5,195 clinical isolates from 15 other countries
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
Moldova (2,057) global set (5,195)
under significant positive selection? NO NO
omega peak height (95%CI lower bound) 1.57 (0.28) 1.51 (0.67)
codons under selection
omega plots
genetic variants* link link
statistics at each codon link link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Symbol mptC mjackson IMP PIM, LM and LAM biosynthesis
Name Polyprenol phosphomannose-dependent alpha-1,2-mannosyltransferase involved in LM branching and ManLAM capping mjackson IMP PIM, LM and LAM biosynthesis
Symbol mptC mjackson IDA PIM, LM and LAM biosynthesis
Name Polyprenol phosphomannose-dependent alpha-1,2-mannosyltransferase involved in LM branching and ManLAM capping mjackson IDA PIM, LM and LAM biosynthesis
Symbol mptC mjackson Polyprenol phosphomannose-dependent alpha-1,2-mannosyltransferase involved in LM branching and ManLAM capping (phenotypic [mycobacterial recombinant strains]; enzymatic)authors,AK. Mishra,K. Krumbach,D. Rittmann,B. Appelmelk,V. Pathak,AK. Pathak,J. Nigou,J. Geurtsen,L. Eggeling,GS. Besra Lipoarabinomannan biosynthesis in Corynebacterineae: the interplay of two (12)-mannopyranosyltransferases MptC and MptD in mannan branching. Mol. Microbiol. 2011
Citation Lipoarabinomannan biosynthesis in Corynebacterineae: the interplay of two (12)-mannopyranosyltransferases MptC and MptD in mannan branching. authors,AK. Mishra,K. Krumbach,D. Rittmann,B. Appelmelk,V. Pathak,AK. Pathak,J. Nigou,J. Geurtsen,L. Eggeling,GS. Besra Mol. Microbiol. 2011 mjackson 21435038 Polyprenol phosphomannose-dependent alpha-1,2-mannosyltransferase involved in LM branching and ManLAM capping (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other TBPWY:PIM, LM and LAM biosynthesis mjackson Polyprenol phosphomannose-dependent alpha-1,2-mannosyltransferase involved in LM branching and ManLAM capping (phenotypic [mycobacterial recombinant strains]; enzymatic)authors,AK. Mishra,K. Krumbach,D. Rittmann,B. Appelmelk,V. Pathak,AK. Pathak,J. Nigou,J. Geurtsen,L. Eggeling,GS. Besra Lipoarabinomannan biosynthesis in Corynebacterineae: the interplay of two (12)-mannopyranosyltransferases MptC and MptD in mannan branching. Mol. Microbiol. 2011
Symbol mptC mjackson Polyprenol phosphomannose-dependent alpha-1,2-mannosyltransferase involved in LM branching and ManLAM capping (phenotypic [mycobacterial recombinant strains]; enzymatic)D. Kaur, S. Berg et al. Biosynthesis of mycobacterial lipoarabinomannan: role of a branching mannosyltransferase. Proc. Natl. Acad. Sci. U.S.A. 2006
Citation Biosynthesis of mycobacterial lipoarabinomannan: role of a branching mannosyltransferase. D. Kaur, S. Berg et al. Proc. Natl. Acad. Sci. U.S.A. 2006 mjackson 16945913 Polyprenol phosphomannose-dependent alpha-1,2-mannosyltransferase involved in LM branching and ManLAM capping (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other TBPWY:PIM, LM and LAM biosynthesis mjackson Polyprenol phosphomannose-dependent alpha-1,2-mannosyltransferase involved in LM branching and ManLAM capping (phenotypic [mycobacterial recombinant strains]; enzymatic)D. Kaur, S. Berg et al. Biosynthesis of mycobacterial lipoarabinomannan: role of a branching mannosyltransferase. Proc. Natl. Acad. Sci. U.S.A. 2006
Symbol mptC mjackson Polyprenol phosphomannose-dependent alpha-1,2-mannosyltransferase involved in LM branching and ManLAM capping (phenotypic [mycobacterial recombinant strains]; enzymatic)D. Kaur, A. Obregn-Henao et al. Lipoarabinomannan of Mycobacterium: mannose capping by a multifunctional terminal mannosyltransferase. Proc. Natl. Acad. Sci. U.S.A. 2008
Citation Lipoarabinomannan of Mycobacterium: mannose capping by a multifunctional terminal mannosyltransferase. D. Kaur, A. Obregn-Henao et al. Proc. Natl. Acad. Sci. U.S.A. 2008 mjackson 19004785 Polyprenol phosphomannose-dependent alpha-1,2-mannosyltransferase involved in LM branching and ManLAM capping (phenotypic [mycobacterial recombinant strains]; enzymatic)
Other TBPWY:PIM, LM and LAM biosynthesis mjackson Polyprenol phosphomannose-dependent alpha-1,2-mannosyltransferase involved in LM branching and ManLAM capping (phenotypic [mycobacterial recombinant strains]; enzymatic)D. Kaur, A. Obregn-Henao et al. Lipoarabinomannan of Mycobacterium: mannose capping by a multifunctional terminal mannosyltransferase. Proc. Natl. Acad. Sci. U.S.A. 2008