Rv2154c (ftsW)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: cell division protein FtsW
- REFSEQ: FtsW-like protein FtsW
- PATRIC: Cell division protein FtsW
- TUBERCULIST: FtsW-like protein FtsW
- NCBI: FtsW-like protein FtsW
- updated information (H37Rv4):
  - gene name: ftsW
  - function:
  - reference:
Type: Not Target
Start: 2413348
End: 2414922
Operon:

Trans-membrane region:
Role: III.C - Cell division
GO terms:
- GO:0071555 - cell wall organization (Uniprot)
- GO:0051301 - cell division (Uniprot)
- GO:0040007 - growth (Uniprot)
- GO:0016757 - transferase activity, transferring glycosyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0016021 - integral component of membrane (Uniprot)
- GO:0016020 - membrane (Uniprot)
- GO:0009252 - peptidoglycan biosynthetic process (Uniprot)
- GO:0008955 - peptidoglycan glycosyltransferase activity (Uniprot)
- GO:0008360 - regulation of cell shape (Uniprot)
- GO:0007049 - cell cycle (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on ftsW:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = -7.854 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

VLTRLLRRGTSDTDGSQTRGAEPVEGQRTGPEEASNPGSARPRTRFGAWLGRPMTSFHLIIAVAALLTTLGLIMVLSASAVRSYDDDGSAWVIFGKQVLW
TLVGLIGGYVCLRMSVRFMRRIAFSGFAITIVMLVLVLVPGIGKEANGSRGWFVVAGFSMQPSELAKMAFAIWGAHLLAARRMERASLREMLIPLVPAAV
VALALIVAQPDLGQTVSMGIILLGLLWYAGLPLRVFLSSLAAVVVSAAILAVSAGYRSDRVRSWLNPENDPQDSGYQARQAKFALAQGGIFGDGLGQGVA
KWNYLPNAHNDFIFAIIGEELGLVGALGLLGLFGLFAYTGMRIASRSADPFLRLLTATTTLWVLGQAFINIGYVIGLLPVTGLQLPLISAGGTSTAATLS
LIGIIANAARHEPEAVAALRAGRDDKVNRLLRLPLPEPYLPPRLEAFRDRKRANPQPAQTQPARKTPRTAPGQPARQMGLPPRPGSPRTADPPVRRSVHH
GAGQRYAGQRRTRRVRALEGQRYG

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.993550; 12 non-insertions in a row out of 18 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.999950; 15 non-insertions in a row out of 18 sites
Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 15 non-insertions in a row out of 18 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 1.000000; 15 non-insertions in a row out of 18 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999950; 15 non-insertions in a row out of 18 sites
Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.03
Essential-Domain	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

RNA processing and modification

Energy production and conversion

Chromatin structure and dynamics

Amino acid transport and metabolism

Cell cycle control, cell division, chromosome partitioning

Carbohydrate transport and metabolism

Nucleotide transport and metabolism

Lipid transport and metabolism

Coenzyme transport and metabolism

Transcription

Translation, ribosomal structure and biogenesis

Cell wall/membrane/envelope biogenesis

Replication, recombination and repair

Posttranslational modification, protein turnover, chaperones

Cell motility

Secondary metabolites biosynthesis, transport and catabolism

Inorganic ion transport and metabolism

Function unknown

General function prediction only

Intracellular trafficking, secretion, and vesicular transport

Signal transduction mechanisms

Extracellular structures

Defense mechanisms

Nuclear structure

Cytoskeleton

BioCyc Co-regulated genes based on gene expression profiling (Systems Biology, Inferelator Network)

Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).

BioCyc Transcription factor binding based on ChIP-Seq (Systems Biology)

Binds To:
- No bindings to other targets were found.
Bound By:
- No bindings from other targets were found.

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1033c (trcR) (Direct binding)
- Rv1353c (-) (Direct binding)
- Rv3830c (-) (Direct binding)
- Rv1816 (-) (Upstream of operon)
- Rv2887 (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Not downregulated by other genes.

Property	Value	Creator	Evidence	PMID	Comment
Citation	Interaction between FtsZ and FtsW of Mycobacterium tuberculosis. P. Datta, A. Dasgupta et al. J. Biol. Chem. 2002	harsharohiratruefriend	IPI	12101218	Affinity purification (physical interaction)
Interaction	PhysicalInteraction Rv2150c	harsharohiratruefriend	IPI		Affinity purification (physical interaction) P. Datta, A. Dasgupta et al. Interaction between FtsZ and FtsW of Mycobacterium tuberculosis. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv2150c	aparna.vchalam	IPI		Affinity purification (physical interaction) P. Datta, A. Dasgupta et al. Interaction between FtsZ and FtsW of Mycobacterium tuberculosis. J. Biol. Chem. 2002
Interaction	PhysicalInteraction Rv2150c	priyadarshinipriyanka2001	IPI		Affinity purification (physical interaction) P. Datta, A. Dasgupta et al. Interaction between FtsZ and FtsW of Mycobacterium tuberculosis. J. Biol. Chem. 2002
Symbol	FtsW-like	mjackson	NR		Cell division
Name	check against rodA (unclear if reference goes with Rv2154c or Rv0017c-rodA (ftsW)	mjackson	NR		Cell division
Symbol	FtsW	rslayden			P. Datta, A. Dasgupta et al. Interaction between FtsW and penicillin-binding protein 3 (PBP3) directs PBP3 to mid-cell, controls cell septation and mediates the formation of a trimeric complex involving FtsZ, FtsW and PBP3 in mycobacteria. Mol. Microbiol. 2006
Name	Cell division protein, PG complex	rslayden			P. Datta, A. Dasgupta et al. Interaction between FtsW and penicillin-binding protein 3 (PBP3) directs PBP3 to mid-cell, controls cell septation and mediates the formation of a trimeric complex involving FtsZ, FtsW and PBP3 in mycobacteria. Mol. Microbiol. 2006
Citation	Interaction between FtsW and penicillin-binding protein 3 (PBP3) directs PBP3 to mid-cell, controls cell septation and mediates the formation of a trimeric complex involving FtsZ, FtsW and PBP3 in mycobacteria. P. Datta, A. Dasgupta et al. Mol. Microbiol. 2006	rslayden		17427288	None
Symbol	FtsW	rslayden			P. Datta, A. Dasgupta et al. Interaction between FtsW and penicillin-binding protein 3 (PBP3) directs PBP3 to mid-cell, controls cell septation and mediates the formation of a trimeric complex involving FtsZ, FtsW and PBP3 in mycobacteria. Mol. Microbiol. 2006
Name	Cell division protein, PG complex	rslayden			P. Datta, A. Dasgupta et al. Interaction between FtsW and penicillin-binding protein 3 (PBP3) directs PBP3 to mid-cell, controls cell septation and mediates the formation of a trimeric complex involving FtsZ, FtsW and PBP3 in mycobacteria. Mol. Microbiol. 2006
Citation	Interaction between FtsW and penicillin-binding protein 3 (PBP3) directs PBP3 to mid-cell, controls cell septation and mediates the formation of a trimeric complex involving FtsZ, FtsW and PBP3 in mycobacteria. P. Datta, A. Dasgupta et al. Mol. Microbiol. 2006	rslayden		17427288	None

TB Genome Annotation Portal