Rv2047c (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: hypothetical protein
- REFSEQ: hypothetical protein
- PATRIC: Phosphoenolpyruvate synthase (EC 2.7.9.2)
- TUBERCULIST: Conserved hypothetical protein
- NCBI: hypothetical protein
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Essential
Start: 2291962
End: 2294526
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0050662 - coenzyme binding (Uniprot)
- GO:0016772 - transferase activity, transferring phosphorus-containing groups (Uniprot)
- GO:0016310 - phosphorylation (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0003824 - catalytic activity (Uniprot)
- GO:0009405 - pathogenesis (FLUTE) (FLUTE Assigned!)
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020):

PDB aa ident species PDB title

2E28 41% Geobacillus stearothermophilus Crystal structure analysis of pyruvate kinase from Bacillus stearothermophilus
Links to additional information on Rv2047c:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 1.598 (from Jeremy Rock's lab)
- KEGG - nucleotide and amino acid sequences of gene
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

PDB	aa ident	species	PDB title
2E28	41%	Geobacillus stearothermophilus	Crystal structure analysis of pyruvate kinase from Bacillus stearothermophilus

Amino Acid Sequence

VRIAVTGASGVLGRGLTARLLSQGHEVVGIARHRPDSWPSSADFIAADIRDATAVESAMTGADVVAHCAWVRGRNDHINIDGTANVLKAMAETGTGRIVF
TSSGHQPRVEQMLADCGLEWVAVRCALIFGRNVDNWVQRLFALPVLPAGYADRVVQVVHSDDAQRLLVRALLDTVIDSGPVNLAAPGELTFRRIAAALGR
PMVPIGSPVLRRVTSFAELELLHSAPLMDVTLLRDRWGFQPAWNAEECLEDFTLAVRGRIGLGKRTFSLPWRLANIQDLPAVDSPADDGVAPRLAGPEGA
NGEFDTPIDPRFPTYLATNLSEALPGPFSPSSASVTVRGLRAGGVGIAERLRPSGVIQREIAMRTVAVFAHRLYGAITSAHFMAATVPFAKPATIVSNSG
FFGPSMASLPIFGAQRPPSESSRARRWLRTLRNIGVFGVNLVGLSAGSPRDTDAYVADVDRLERLAFDNLATHDDRRLLSLILLARDHVVHGWVLASGSF
MLCAAFNVLLRGLCGRDTAPAAGPELVSARSVEAVQRLVAAARRDPVVIRLLAEPGERLDKLAVEAPEFHSAVLAELTLIGHRGPAEVEMAATSYADNPE
LLVRMVAKTLRAVPAPQPPTPVIPLRAKPVALLAARQLRDREVRRDRMVRAIWVLRALLREYGRRLTEAGVFDTPDDVFYLLVDEIDALPADVSGLVARR
RAEQRRLAGIVPPTVFSGSWEPSPSSAAALAAGDTLRGVGVCGGRVRGRVRIVRPETIDDLQPGEILVAEVTDVGYTAAFCYAAAVVTELGGPMSHAAVV
AREFGFPCVVDAQGATRFLPPGALVEVDGATGEIHVVELASEDGPALPGSDLSR

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Uncertain	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.589500; 9 non-insertions in a row out of 32 sites
Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 1.000000; 21 non-insertions in a row out of 32 sites
Uncertain	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.865100; 8 non-insertions in a row out of 32 sites
Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.997850; 12 non-insertions in a row out of 32 sites
Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.999950; 18 non-insertions in a row out of 32 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 0.25
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0678 (-) (Upstream of operon)
- Rv0767c (-) (Upstream of operon)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Rv0260c (-)
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0023 (-)
- Rv3058c (-)

Property	Value	Creator	Evidence	PMID	Comment
Citation	Novel intermolecular iterative mechanism for biosynthesis of mycoketide catalyzed by a bimodular polyketide synthase. T. Chopra, S. Banerjee et al. PLoS Biol. 2008	ravirajsoni	NAS	18613748	None
Interaction	Activates Rv2048c	ravirajsoni	NAS		T. Chopra, S. Banerjee et al. Novel intermolecular iterative mechanism for biosynthesis of mycoketide catalyzed by a bimodular polyketide synthase. PLoS Biol. 2008

TB Genome Annotation Portal