TB Genome Annotation Portal

Rv1853 (ureD)

Amino Acid Sequence

VVASPNRLPRIDCRGGVQARRTAPDTVHLVSAAATPLGGDTMRIRVIVERGAQLRLRSAAATVALPGVDTLTSHAHWEIDVTGTLDVDLEPTVVAASARH
LSHATLRLHDDGRVRLRERVQIGRCNEREGFWSSSLQADRHGRPLLRHRVELGAGSLADDVIAAPRATISELRYPATAFTDAIDARSTVLALAGGGTLST
WQADRLPG
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.64 (0.34)1.44 (0.62)
codons under selection
omega plots
genetic variantslinklink
statistics at each codonlinklink

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Non-Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
2 non-insertions in a row out of 6 sites
Non-Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 6 sites
Non-Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.000000;
3 non-insertions in a row out of 6 sites
Non-Essential minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.000000;
1 non-insertions in a row out of 7 sites
Uncertain minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.388250;
3 non-insertions in a row out of 7 sites
Non-Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Non-Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.75
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

    Interactions based on TFOE data (Rustad et al. 2014)

    • Upregulates:

      • Does not upregulate other genes.
    • Upregulated by:

    • Downregulates:

      • Does not downregulate other genes.
    • Downregulated by:



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1853 (ureD)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv1852sourish10NASStructural Analysis
    authors,JE. Habel,EH. Bursey,BS. Rho,CY. Kim,BW. Segelke,B. Rupp,MS. Park,TC. Terwilliger,LW. Hung Structure of Rv1848 (UreA), the Mycobacterium tuberculosis urease gamma subunit. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010
    CitationStructure of Rv1848 (UreA), the Mycobacterium tuberculosis urease gamma subunit. authors,JE. Habel,EH. Bursey,BS. Rho,CY. Kim,BW. Segelke,B. Rupp,MS. Park,TC. Terwilliger,LW. Hung Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010sourish10NAS20606272Spectrophotometric Assay
    InteractionPhysicalInteraction Rv1852sourish10NASSpectrophotometric Assay
    authors,JE. Habel,EH. Bursey,BS. Rho,CY. Kim,BW. Segelke,B. Rupp,MS. Park,TC. Terwilliger,LW. Hung Structure of Rv1848 (UreA), the Mycobacterium tuberculosis urease gamma subunit. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010
    InteractionPhysicalInteraction Rv1851sourish10NASSpectrophotometric Assay
    authors,JE. Habel,EH. Bursey,BS. Rho,CY. Kim,BW. Segelke,B. Rupp,MS. Park,TC. Terwilliger,LW. Hung Structure of Rv1848 (UreA), the Mycobacterium tuberculosis urease gamma subunit. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010
    CitationStructure of Rv1848 (UreA), the Mycobacterium tuberculosis urease gamma subunit. authors,JE. Habel,EH. Bursey,BS. Rho,CY. Kim,BW. Segelke,B. Rupp,MS. Park,TC. Terwilliger,LW. Hung Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010sourish10NAS20606272Structural Analysis
    InteractionPhysicalInteraction Rv1852sourish10NASStructural Analysis
    authors,JE. Habel,EH. Bursey,BS. Rho,CY. Kim,BW. Segelke,B. Rupp,MS. Park,TC. Terwilliger,LW. Hung Structure of Rv1848 (UreA), the Mycobacterium tuberculosis urease gamma subunit. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010
    InteractionPhysicalInteraction Rv1851sourish10NASStructural Analysis
    authors,JE. Habel,EH. Bursey,BS. Rho,CY. Kim,BW. Segelke,B. Rupp,MS. Park,TC. Terwilliger,LW. Hung Structure of Rv1848 (UreA), the Mycobacterium tuberculosis urease gamma subunit. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010
    InteractionPhysicalInteraction Rv1851sourish10NASStructural Analysis
    authors,JE. Habel,EH. Bursey,BS. Rho,CY. Kim,BW. Segelke,B. Rupp,MS. Park,TC. Terwilliger,LW. Hung Structure of Rv1848 (UreA), the Mycobacterium tuberculosis urease gamma subunit. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010
    InteractionPhysicalInteraction Rv1852sourish10NASSpectrophotometric Assay
    authors,JE. Habel,EH. Bursey,BS. Rho,CY. Kim,BW. Segelke,B. Rupp,MS. Park,TC. Terwilliger,LW. Hung Structure of Rv1848 (UreA), the Mycobacterium tuberculosis urease gamma subunit. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010
    InteractionPhysicalInteraction Rv1851sourish10NASSpectrophotometric Assay
    authors,JE. Habel,EH. Bursey,BS. Rho,CY. Kim,BW. Segelke,B. Rupp,MS. Park,TC. Terwilliger,LW. Hung Structure of Rv1848 (UreA), the Mycobacterium tuberculosis urease gamma subunit. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2010
    InteractionRegulatedBy Rv3286cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
    InteractionRegulatedBy Rv3286cyamir.morenoIEPMicroarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique.
    EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
    CitationPurification, characterization, and genetic analysis of Mycobacterium tuberculosis urease, a potentially critical determinant of host-pathogen interaction. authors,DL. Clemens,BY. Lee,MA. Horwitz J. Bacteriol. 1995jjmcfadden7559354Inferred from direct assay
    TermEC:3.5.1.5 Urease. - NRjjmcfaddenNRInferred from direct assay
    authors,DL. Clemens,BY. Lee,MA. Horwitz Purification, characterization, and genetic analysis of Mycobacterium tuberculosis urease, a potentially critical determinant of host-pathogen interaction. J. Bacteriol. 1995

    Comments