TB Genome Annotation Portal

Rv1852 (ureG)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: urease accessory protein ureG
  • REFSEQ: urease accessory protein ureG
  • PATRIC: Urease accessory protein UreG
  • TUBERCULIST: Urease accessory protein UreG
  • NCBI: Urease accessory protein UreG
  • updated information (H37Rv4):
    • gene name: ureG
    • function:
    • reference:
• Type: Not Target
• Start: 2100340
• End: 2101014
• Operon:


• Trans-membrane region:
  
• Role: I.A.2 - Amino acids and amines
• GO terms:
  • GO:0016151 - nickel cation binding (Uniprot)
  • GO:0006807 - nitrogen compound metabolic process (Uniprot)
  • GO:0005737 - cytoplasm (Uniprot)
  • GO:0005525 - GTP binding (Uniprot)
  • GO:0005515 - protein binding (Uniprot)
  • GO:0003924 - GTPase activity (Uniprot)
  • GO:0000166 - nucleotide binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5XKT	56%	Klebsiella pneumoniae subsp. rhinoscleromatis SB3432	Klebsiella pneumoniae UreG in complex with GMPPNP and nickel
  4HI0	55%	Helicobacter pylori	Crystal Structure of Helicobacter pylori Urease Accessory Protein UreF/H/G complex

• Links to additional information on ureG:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.675 (from Jeremy Rock's lab)

Amino Acid Sequence

MATHSHPHSHTVPARPRRVRKPGEPLRIGVGGPVGSGKTALVAALCRQLRGELSLAVLTNDIYTTEDADFLRTHAVLPDDRIAAVQTGGCPHTAIRDDIT
ANLDAIDELMAAHDALDLILVESGGDNLTATFSSGLVDAQIFVIDVAGGDKVPRKGGPGVTYSDLLVVNKTDLAALVGADLAVMARDADAVRDGRPTVLQ
SLTEDPAASDVVAWVRSQLAADGV

Additional Information