TB Genome Annotation Portal

Rv1825 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: hypothetical protein
  • REFSEQ: hypothetical protein
  • PATRIC: Division initiation protein
  • TUBERCULIST: Conserved protein
  • NCBI: hypothetical protein
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 2071036
• End: 2071914
• Operon:


• Trans-membrane region:
  
• Role: VI - Unknowns
• GO terms:
  • GO:0016021 - integral component of membrane (Uniprot)
  • GO:0016020 - membrane (Uniprot)
  • GO:0005887 - integral component of plasma membrane (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005576 - extracellular region (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure: 3gmg
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3GMG	99%	Mycobacterium tuberculosis	Crystal structure of an uncharacterized conserved protein from Mycobacterium tuberculosis

• Links to additional information on Rv1825:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.44 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VSENRPEPVAAETSAATTARHSQADAGAHDAVRRGRHELPADHPRSKVGPLRRTRLTEILRGGRSRLVFGTLAILLCLVLGVAIVTQVRQTDSGDSLETA
RPADLLVLLDSLRQREATLNAEVIDLQNTLNALQASGNTDQAALESAQARLAALSILVGAVGATGPGVMITIDDPGPGVAPEVMIDVINELRAAGAEAIQ
INDAHRSVRVGVDTWVVGVPGSLTVDTKVLSPPYSILAIGDPPTLAAAMNIPGGAQDGVKRVGGRMVVQQADRVDVTALRQPKQHQYAQPVK

Additional Information