TB Genome Annotation Portal

Rv1791 (PE19)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: PE family protein
  • REFSEQ: PE family protein
  • PATRIC: PE family protein
  • TUBERCULIST: PE family protein PE19
  • NCBI: PE family protein PE19
  • updated information (H37Rv4):
    • gene name: PE19
    • function:
    • reference:
• Type: Not Target
• Start: 2029904
• End: 2030203
• Operon:


• Trans-membrane region:
  
• Role: IV.C.1.a - PE subfamily
• GO terms:
  • No terms assigned.
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  5XFS	62%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of PE8-PPE15 in complex with EspG5 from M. tuberculosis
  4W4L	39%	Mycobacterium tuberculosis	Crystal structure of EspG5 in complex with PE25 and PPE41 from the ESX-5 type VII secretion system of M. tuberculosis
  4KXR	39%	Mycobacterium tuberculosis	Structure of the Mycobacterium tuberculosis type VII secretion system chaperone EspG5 in complex with PE25-PPE41 dimer
  2G38	39%	Mycobacterium tuberculosis	A PE/PPE Protein Complex from Mycobacterium tuberculosis

• Links to additional information on PE19:
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = -0.962 (from Jeremy Rock's lab)
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MSFVTTQPEALAAAAANLQGIGTTMNAQNAAAAAPTTGVVPAAADEVSALTAAQFAAHAQMYQTVSAQAAAIHEMFVNTLVASSGSYAATEAANAAAAG

Additional Information