TB Genome Annotation Portal

Rv1786 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: oxidoreductase
  • REFSEQ: ferredoxin
  • PATRIC: Putative ferredoxin
  • TUBERCULIST: Probable ferredoxin
  • NCBI: Probable ferredoxin
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference: Lu (2017) PMID: 28812125
• Type: Not Target
• Start: 2024828
• End: 2025031
• Operon:


• Trans-membrane region:
  
• Role: I.B.7 - Miscellaneous oxidoreductases and oxygenases
• GO terms:
  • No terms assigned.
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4OV1	37%	Rhodopseudomonas palustris	The crystal structure of a novel electron transfer ferredoxin from R. palustris HaA2
  4ID8	37%	Rhodopseudomonas palustris	The crystal structure of a [3Fe-4S] ferredoxin associated with CYP194A4 from R. palustris HaA2

• Links to additional information on Rv1786:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.521 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

VKVRLDPSRCVGHAQCYAVDPDLFPIDDSGNSILAEHEVRPEDMQLTRDGVAACPEMALILEEDDAD

Additional Information