Rv1760 (-)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: acyltransferase WS/DGAT/MGAT
- REFSEQ: hypothetical protein
- PATRIC: Wax ester synthase/acyl-CoA:diacylglycerol acyltransferase
- TUBERCULIST: Possible triacylglycerol synthase (diacylglycerol acyltransferase)
- NCBI: Possible triacylglycerol synthase (diacylglycerol acyltransferase)
- updated information (H37Rv4):
  - gene name: -
  - function:
  - reference:
Type: Not Target
Start: 1993153
End: 1994661
Operon:

Trans-membrane region:
Role: V - Conserved hypotheticals
GO terms:
- GO:0071731 - response to nitric oxide (Uniprot)
- GO:0047196 - long-chain-alcohol O-fatty-acyltransferase activity (Uniprot)
- GO:0045017 - glycerolipid biosynthetic process (Uniprot)
- GO:0044119 - growth of symbiont in host cell (Uniprot)
- GO:0019432 - triglyceride biosynthetic process (Uniprot)
- GO:0016746 - transferase activity, transferring acyl groups (Uniprot)
- GO:0016740 - transferase activity (Uniprot)
- GO:0006629 - lipid metabolic process (Uniprot)
- GO:0006071 - glycerol metabolic process (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
- GO:0005618 - cell wall (Uniprot)
- GO:0004144 - diacylglycerol O-acyltransferase activity (Uniprot)
- GO:0001666 - response to hypoxia (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- 0.11 HEXACOSANOYL_COA[c] + 0.22 HEXADECANOYL_COA[c] + 0.11 9_HEXADECENOYL_COA[c] + 0.11 OCTADECANOYL_COA[c] + 0.11 9_OCTADECENOY... <Preview truncated at 128 characters>
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB
Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
Links to additional information on Rv1760:
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.996 (from Jeremy Rock's lab)
- Mycobrowser
- PATRIC
- KEGG - nucleotide and amino acid sequences of gene
- BioCyc
- Systems Biology

Amino Acid Sequence

MPRGCAGARFACNACLNFLAGLGISEPISPGWAAMERLSGLDAFFLYMETPSQPLNVCCVLELDTSTMPGGYTYGRFHAALEKYVKAAPEFRMKLADTEL
NLDHPVWVDDDNFQIRHHLRRVAMPAPGGRRELAEICGYIAGLPLDRDRPLWEMWVIEGGARSDTVAVMLKVHHAVVDGVAGANLLSHLCSLQPDAPAPQ
PVRGTGGGNVLQIAASGLEGFASRPVRLATVVPATVLTLVRTLLRAREGRTMAAPFSAPPTPFNGPLGRLRNIAYTQLDMRDVKRVKDRFGVTINDVVVA
LCAGALRRFLLEHGVLPEAPLVATVPVSVHDKSDRPGRNQATWMFCRVPSQISDPAQRIRTIAAGNTVAKDHAAAIGPTLLHDWIQFGGSTMFGAAMRIL
PHISITHSPAYNLILSNVPGPQAQLYFLGCRMDSMFPLGPLLGNAGLNITVMSLNGELGVGIVSCPDLLPDLWGVADGFPEALKELLECSDDQPEGSNHQ
DS

(Nucleotide sequence available on KEGG)

Additional Information

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification	Condition	Strain	Method	Reference	Notes
Non-Essential	Sodium Oleate	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 2 non-insertions in a row out of 28 sites
Non-Essential	Lignoceric Acid	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 28 sites
Non-Essential	Phosphatidylcholine	H37RvMA	Gumbel	Subhalaxmi Nambi	Probability of Essentiality: 0.000000; 1 non-insertions in a row out of 28 sites
Non-Essential	minimal media + 0.1% glycerol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000100; 4 non-insertions in a row out of 28 sites
Non-Essential	minimal media + 0.01% cholesterol	H37RvMA	Gumbel	Griffin et al. (2011)	Probability of Essentiality: 0.000050; 4 non-insertions in a row out of 28 sites
Non-Essential	7H10-glycerol	H37RvMA	TraSH	Sassetti et al. (2003a)
Non-Essential	C57BL/6J mice (8 weeks)	H37RvMA	TraSH	Sassetti et al. (2003b)	Hybridization Ratio: 3.72
Non-Essential	7H09/7H10 + rich media	H37RvMA	MotifHMM	DeJesus et al. (2017)	Fully saturated (14 reps).

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv0678 (-) (Direct binding)
- Rv3249c (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv0377 (-)
- Rv1152 (-)

Property	Value	Creator	Evidence	PMID	Comment
Citation	Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. G. Bai, LA. McCue et al. J. Bacteriol. 2005	priyadarshinipriyanka2001	RCA	16267303	Band Shift
Interaction	Transcription Rv3676	priyadarshinipriyanka2001	RCA		Band Shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Citation	Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. TD. Sirakova, VS. Dubey et al. Microbiology (Reading, Engl.) 2006	priyadarshinipriyanka2001	RCA	16946266	Band Shift
Interaction	Transcription Rv3676	priyadarshinipriyanka2001	RCA		Band Shift TD. Sirakova, VS. Dubey et al. Identification of a diacylglycerol acyltransferase gene involved in accumulation of triacylglycerol in Mycobacterium tuberculosis under stress. Microbiology (Reading, Engl.) 2006
Name	Putative acyl CoA:diacylglycerol acyltransferase	mjackson	IDA		Triglyceride biosynthesis
Citation	Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Daniel, C. Deb et al. J. Bacteriol. 2004	mjackson		15262939	Putative acyl CoA:diacylglycerol acyltransferase (enzymatic)
Other	TBPWY:Triglyceride biosynthesis	mjackson			Putative acyl CoA:diacylglycerol acyltransferase (enzymatic) J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004

TB Genome Annotation Portal