Rv1746 (pknF)
Current annotations:
TBCAP: (community-based annotations - see table at bottom of page )
TBDB: serine/threonine-protein kinase pknF
REFSEQ: anchored-membrane serine/threonine-protein kinase PKNF (protein kinase F) (STPK F)
PATRIC: Probable serine/threonine-protein kinase pknF (EC 2.7.11.1)
TUBERCULIST: Anchored-membrane serine/threonine-protein kinase PknF (protein kinase F) (STPK F)
NCBI: Anchored-membrane serine/threonine-protein kinase PknF (protein kinase F) (STPK F)
updated information (H37Rv4):
gene name: pknF
function:
reference:
Coordinates in H37Rv: 1972138 - 1973568
Gene length: 1431 bp (with stop codon), 476 aa (without stop codon)
Operon:
Trans-membrane region:
Role: I.J.3 - Serine-Threonine protein kinases and phosphoprotein phosphatases
GO terms:
Reaction(s) (based on iSM810 metabolic model):
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Latest Homologs in PDB
Top 10 Homologs in PDB (as of Apr 2026): PDB aa ident species PDB title 7NAA 100% Mycobacterium tuberculosis Crystal structure of Mycobacterium tuberculosis H37Rv PknF kinase domain 5XKA 50% Mycobacterium tuberculosis Crystal structure of M.tuberculosis PknI kinase domain 5M07 50% Mycobacterium tuberculosis H37Rv Crystal structure of Mycobacterium tuberculosis PknI kinase domain, C20A mutant 5M06 50% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal structure of Mycobacterium tuberculosis PknI kinase domain 5M09 49% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal structure of Mycobacterium tuberculosis PknI kinase domain, C20A_R136N double mutant 5M08 49% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal structure of Mycobacterium tuberculosis PknI kinase domain, C20A_R136A double mutant 6B2P 41% Mycobacterium tuberculosis Dual Inhibition of the Essential Protein Kinases A and B in Mycobacterium tuberculosis 5U94 41% Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) Crystal structure of the Mycobacterium tuberculosis PASTA kinase PknB in complex with the potential theraputic kinase inhibitor GSK690693. 2FUM 41% Mycobacterium tuberculosis H37Rv Catalytic domain of protein kinase PknB from Mycobacterium tuberculosis in complex with mitoxantrone 1O6Y 41% MYCOBACTERIUM TUBERCULOSIS Catalytic domain of PknB kinase from Mycobacterium tuberculosis
Links to additional information on pknF:
Amino Acid Sequence
MPLAEGSTFAGFTIVRQLGSGGMGEVYLARHPRLPRQDALKVLRADVSADGEYRARFNREADAAASLWHPHIVAVHDRGEFDGQLWIDMDFVDGTDTVSL
LRDRYPNGMPGPEVTEIITAVAEALDYAHERRLLHRDVKPANILIANPDSPDRRIMLADFGIAGWVDDPSGLTATNMTVGTVSYAAPEQLMGNELDGRAD
QYALAATAFHLLTGSPPFQHANPAVVISQHLSASPPAIGDRVPELTPLDPVFAKALAKQPKDRYQRCVDFARALGHRLGGAGDPDDTRVSQPVAVAAPAK
RSLLRTAVIVPAVLAMLLVMAVAVAVREFQRADDERAAQPARTRTTTSAGTTTSVAPASTTRPAPTTPTTTGAADTATASPTAAVVAIGALCFPLGSTGT
TKTGATAYCSTLQGTNTTIWSLTEDTVASPTVTATADPTEAPLPIEQESPIRVCMQQTGQTRRECREEIRRSNGWP
(
Nucleotide sequence available on
KEGG )
Additional Information
MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb
TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions
Rv1746/pknF,
gene len: 1430 bp, num TA sites: 13
condition dataset call medium method notes
in-vitro DeJesus 2017 mBio non-essential 7H9 HMM fully saturated, 14 TnSeq libraries combined
in-vitro Sassetti 2003 Mol Micro non-essential 7H9 TRASH essential if hybridization ratio<0.2
in-vivo (mice) Sassetti 2003 PNAS no data BL6 mice TRASH essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol) Griffin 2011 PPath non-essential M9 minimal+glycerol Gumbel 2 replicates; Padj<0.05
in-vitro (cholesterol) Griffin 2011 PPath non-essential M9 minimal+cholesterol Gumbel 3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPath NO (LFC=-0.15) cholesterol vs glycerol resampling-SR YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro Smith 2022 eLife non-essential 7H9 HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice) Smith 2022 eLife non-essential BL6 mice HMM 6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice Smith 2022 eLife NO (LFC=0.253) in-vivo vs in-vitro ZINB YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal) Minato 2019 mSys non-essential minimal medium HMM
in-vitro (YM rich medium) Minato 2019 mSys non-essential YM rich medium HMM 7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich medium Minato 2019 mSys NO (LFC=-0.79) YM rich vs minimal medium resampling
Analysis of Positive Selection in Clinical Isolates
*new*
data from Culviner et al (2025) (55,259 Mtb clinical isolates)
overall pN/pS for Rv1746: 0.731745082
lineage-specific pN/pS in L1: 0.601453403
lineage-specific pN/pS in L2: 0.822900652
lineage-specific pN/pS in L3: 0.70565943
lineage-specific pN/pS in L4: 0.775583864
Analysis of dN/dS (omega) in a global collection of 10k Mtb clinical isolates using GenomegaMap (Window model)
clinical isolates collection: global set of 10,626 Mtb genomes
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.
global set of 10,626 Mtb clinical isolates
under significant positive selection? NO
omega peak height (95%CI lower bound) 1.38 (0.74)
codons under selection
omega plots
genetic variants* link
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"
TnSeq Data No data currently available.
No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
No Proteomic data currently available for this Target.
Regulatory Relationships from Systems Biology
BioCyc
Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology )
NOTE:
see table of TFOE interactions below
Interactions based on ChIPSeq data
RNA processing and modification
Energy production and conversion
Chromatin structure and dynamics
Amino acid transport and metabolism
Cell cycle control, cell division, chromosome partitioning
Carbohydrate transport and metabolism
Nucleotide transport and metabolism
Lipid transport and metabolism
Coenzyme transport and metabolism
Translation, ribosomal structure and biogenesis
Cell wall/membrane/envelope biogenesis
Replication, recombination and repair
Posttranslational modification, protein turnover, chaperones
Secondary metabolites biosynthesis, transport and catabolism
Inorganic ion transport and metabolism
General function prediction only
Intracellular trafficking, secretion, and vesicular transport
Signal transduction mechanisms
Differentially expressed as result of RNASeq in glycerol environment (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Conditionally essential as result of TNSeq (Only top 20 genes shown sorted by log fold change with p_adj 0.05).
Binds To:
No bindings to other targets were found.
Bound By:
No bindings from other targets were found.
Binds To:
No bindings to other targets were found.
Bound By:
TFOE = Transcription Factor Over-Expression study
significance criteria used in paper: greater than 2-fold change (|LFC|>=1.0) and Padj<0.01
no significant interactions found
Upregulates:
Does not upregulate other genes.
Upregulated by:
Not upregulated by other genes.
Downregulates:
Does not downregulate other genes.
Downregulated by:
Not downregulated by other genes.
Property Value Creator Evidence PMID Comment
Interaction Signaling Rv1747 aparna.vchalam IPI Yeast two-hybrid (Physical interaction)JM. Curry, R. Whalan et al. An ABC transporter containing a forkhead-associated domain interacts with a serine-threonine protein kinase and is required for growth of Mycobacterium tuberculosis in mice. Infect. Immun. 2005
Interaction Signaling Rv1747 aparna.vchalam IPI Yeast two-hybrid (Physical interaction)V. Molle, D. Soulat et al. Two FHA domains on an ABC transporter, Rv1747, mediate its phosphorylation by PknF, a Ser/Thr protein kinase from Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2004
Citation Two FHA domains on an ABC transporter, Rv1747, mediate its phosphorylation by PknF, a Ser/Thr protein kinase from Mycobacterium tuberculosis. V. Molle, D. Soulat et al. FEMS Microbiol. Lett. 2004 aparna.vchalam IPI 15135525 Yeast two-hybrid (Physical interaction)
Interaction Signaling Rv1747 aparna.vchalam IPI Yeast two-hybrid (Physical interaction)V. Molle, D. Soulat et al. Two FHA domains on an ABC transporter, Rv1747, mediate its phosphorylation by PknF, a Ser/Thr protein kinase from Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2004
Citation Role of Mycobacterium tuberculosis Ser/Thr kinase PknF: implications in glucose transport and cell division. P. Deol, R. Vohra et al. J. Bacteriol. 2005 aparna.vchalam IPI 15866927 Yeast two-hybrid (Physical interaction)
Interaction Signaling Rv1747 aparna.vchalam IPI Yeast two-hybrid (Physical interaction)P. Deol, R. Vohra et al. Role of Mycobacterium tuberculosis Ser/Thr kinase PknF: implications in glucose transport and cell division. J. Bacteriol. 2005
Interaction Signaling Rv1747 priyadarshinipriyanka2001 IPI Yeast two-hybrid (Physical interaction)JM. Curry, R. Whalan et al. An ABC transporter containing a forkhead-associated domain interacts with a serine-threonine protein kinase and is required for growth of Mycobacterium tuberculosis in mice. Infect. Immun. 2005
Interaction Signaling Rv1747 priyadarshinipriyanka2001 IPI Yeast two-hybrid (Physical interaction)V. Molle, D. Soulat et al. Two FHA domains on an ABC transporter, Rv1747, mediate its phosphorylation by PknF, a Ser/Thr protein kinase from Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2004
Citation Two FHA domains on an ABC transporter, Rv1747, mediate its phosphorylation by PknF, a Ser/Thr protein kinase from Mycobacterium tuberculosis. V. Molle, D. Soulat et al. FEMS Microbiol. Lett. 2004 priyadarshinipriyanka2001 IPI 15135525 Yeast two-hybrid (Physical interaction)
Interaction Signaling Rv1747 priyadarshinipriyanka2001 IPI Yeast two-hybrid (Physical interaction)V. Molle, D. Soulat et al. Two FHA domains on an ABC transporter, Rv1747, mediate its phosphorylation by PknF, a Ser/Thr protein kinase from Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2004
Citation Role of Mycobacterium tuberculosis Ser/Thr kinase PknF: implications in glucose transport and cell division. P. Deol, R. Vohra et al. J. Bacteriol. 2005 priyadarshinipriyanka2001 IPI 15866927 Yeast two-hybrid (Physical interaction)
Interaction Signaling Rv1747 priyadarshinipriyanka2001 IPI Yeast two-hybrid (Physical interaction)P. Deol, R. Vohra et al. Role of Mycobacterium tuberculosis Ser/Thr kinase PknF: implications in glucose transport and cell division. J. Bacteriol. 2005
Interaction Signaling Rv0020c vmevada102 IEP Affinity purification (Physical interaction)C. Grundner, LM. Gay et al. Mycobacterium tuberculosis serine/threonine kinases PknB, PknD, PknE, and PknF phosphorylate multiple FHA domains. Protein Sci. 2005
Name TRANSMEMBRANE SERINE/THREONINE-PROTEIN KINASE, known to phosphorylate FabH, and InhA (not as well as PknA and PknB), KasA, KasB mjackson IDA Regulatory proteins