TB Genome Annotation Portal

Rv1741 (vapC34)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: toxin
  • REFSEQ: hypothetical protein
  • PATRIC: Toxin 1 PIN domain
  • TUBERCULIST: Possible toxin VapC34. Contains PIN domain.
  • NCBI: Possible toxin VapC34 Contains PIN domain
  • updated information (H37Rv4):
    • gene name: vapC34
    • function:
    • reference:
• Type: Not Target
• Start: 1967917
• End: 1968165
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0090305 - nucleic acid phosphodiester bond hydrolysis (Uniprot)
  • GO:0046872 - metal ion binding (Uniprot)
  • GO:0016787 - hydrolase activity (Uniprot)
  • GO:0004518 - nuclease activity (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  4XGR	46%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of addiction module from Mycobacterial species
  4XGQ	46%	Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)	Crystal structure of addiction module from Mycobacterial species

• Links to additional information on vapC34:
  • KEGG - nucleotide and amino acid sequences of gene
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 0.763 (from Jeremy Rock's lab)
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MVIDTSALVAMLNDEPEAQRFEIAVAADHVWLMSTASYPEMATVIETRFGEPGGREPKVSGQPLLYKGDDFACIDIRAVLAG

Additional Information