Rv1731 (gabD2)

Current annotations:
- TBCAP: (community-based annotations - see table at bottom of page)
- TBDB: succinate-semialdehyde dehydrogenase (NADP+)
- REFSEQ: succinic semialdehyde dehydrogenase
- PATRIC: Aldehyde dehydrogenase (EC 1.2.1.3)
- TUBERCULIST: Possible succinate-semialdehyde dehydrogenase [NADP+] dependent (SSDH) GabD2
- NCBI: Possible succinate-semialdehyde dehydrogenase [NADP+] dependent (SSDH) GabD2
- updated information (H37Rv4):
  - gene name: gabD2
  - function:
  - reference:
Type: Not Target
Start: 1957677
End: 1959233
Operon:

Trans-membrane region:
Role: I.A.1 - Carbon compounds
GO terms:
- GO:0055114 - oxidation-reduction process (Uniprot)
- GO:0016620 - oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor (Uniprot)
- GO:0016491 - oxidoreductase activity (Uniprot)
- GO:0009013 - succinate-semialdehyde dehydrogenase [NAD(P)+] activity (Uniprot)
- GO:0008152 - metabolic process (Uniprot)
- GO:0006099 - tricarboxylic acid cycle (Uniprot)
- GO:0005886 - plasma membrane (Uniprot)
Reaction(s) (based on iSM810 metabolic model):
- NADP[c] + SUCCSAL[c] -> NADPH[c] + SUCC[c]
Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
Orthologs among selected mycobacteria
Protein structure:
Search for Homologs in PDB

Top 10 Homologs in PDB (as of Nov 2020):

PDB	aa ident	species	PDB title
4LIH	36%	Burkholderia cenocepacia	The crystal structure of Gamma-glutamyl-gamma-aminobutyraldehyde dehydrogenase from Burkholderia cenocepacia J2315
4V6H	36%	Burkholderia pseudomallei	Crystal structure of succinate-semialdehyde dehydrogenase from Burkholderia pseudomallei
4YWE	35%	Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610)	Crystal Structure of a Putative Aldehyde Dehydrogenase from Burkholderia cenocepacia
3B4W	35%	Mycobacterium tuberculosis	Crystal structure of Mycobacterium tuberculosis aldehyde dehydrogenase complexed with NAD+

Links to additional information on gabD2:
- KEGG - nucleotide and amino acid sequences of gene
- TBDB (updated)
- Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
- UniProt
- AlphaFold model
- Vulnerability = 0.981 (from Jeremy Rock's lab)
- Mycobrowser
- PATRIC
- BioCyc
- Systems Biology

Amino Acid Sequence

MPAPSAEVFDRLRNLAAIKDVAARPTRTIDEVFTGKPLTTIPVGTAADVEAAFAEARAAQTDWAKRPVIERAAVIRRYRDLVIENREFLMDLLQAEAGKA
RWAAQEEIVDLIANANYYARVCVDLLKPRKAQPLLPGIGKTTVCYQPKGVVGVISPWNYPMTLTVSDSVPALVAGNAVVLKPDSQTPYCALACAELLYRA
GLPRALYAIVPGPGSVVGTAITDNCDYLMFTGSSATGSRLAEHAGRRLIGFSAELGGKNPMIVARGANLDKVAKAATRACFSNAGQLCISIERIYVEKDI
AEEFTRKFGDAVRNMKLGTAYDFSVDMGSLISEAQLKTVSGHVDDATAKGAKVIAGGKARPDIGPLFYEPTVLTNVAPEMECAANETFGPVVSIYPVADV
DEAVEKANDTDYGLNASVWAGSTAEGQRIAARLRSGTVNVDEGYAFAWGSLSAPMGGMGLSGVGRRHGPEGLLKYTESQTIATARVFNLDPPFGIPATVW
QKSLLPIVRTVMKLPGRR

(Nucleotide sequence available on KEGG)

Additional Information

Analysis of Positive Selection in Clinical Isolates new

Analysis of dN/dS (omega) in two collections of Mtb clinical isolates using GenomegaMap (Window model) (see description of methods)
- Moldova: 2,057 clinical isolates
- global set: 5,195 clinical isolates from 15 other countries
In the omega plots, the black line shows the mean estimate of omega (dN/dS) at each codon, and the blue lines are the bounds for the 95% credible interval (95%CI, from MCMC sampling).
A gene is under significant positive selection if the lower-bound of the 95%CI of omega (lower blue line) exceeds 1.0 at any codon.

	Moldova (2,057)	global set (5,195)
under significant positive selection?	NO	NO
omega peak height (95%CI lower bound)	1.74 (0.29)	1.62 (0.78)
codons under selection
omega plots
genetic variants*	link	link
statistics at each codon	link	link

* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"

ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1731/gabD2, gene len: 1556 bp, num TA sites: 25

condition	dataset	call	medium	method	notes
in-vitro	DeJesus 2017 mBio	non-essential	7H9	HMM	fully saturated, 14 TnSeq libraries combined
in-vitro	Sassetti 2003 Mol Micro	non-essential	7H9	TRASH	essential if hybridization ratio<0.2
in-vivo (mice)	Sassetti 2003 PNAS	non-essential	BL6 mice	TRASH	essential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)	Griffin 2011 PPath	non-essential	M9 minimal+glycerol	Gumbel	2 replicates; Padj<0.05
in-vitro (cholesterol)	Griffin 2011 PPath	non-essential	M9 minimal+cholesterol	Gumbel	3 replicates; Padj<0.05
differentially essential in cholesterol	Griffin 2011 PPath	NO (LFC=0.0)	cholesterol vs glycerol	resampling-SR	YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitro	Smith 2022 eLife	non-essential	7H9	HMM	6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)	Smith 2022 eLife	non-essential	BL6 mice	HMM	6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in mice	Smith 2022 eLife	NO (LFC=-0.137)	in-vivo vs in-vitro	ZINB	YES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)	Minato 2019 mSys	non-essential	minimal medium	HMM
in-vitro (YM rich medium)	Minato 2019 mSys	non-essential	YM rich medium	HMM	7H9 supplemented with ~20 metabolites (amino acids, vitamins)
differentially essential in YM rich medium	Minato 2019 mSys	NO (LFC=-0.1)	YM rich vs minimal medium	resampling

TnSeq Data No data currently available.

No TnSeq data currently available for this Target.

RNASeq Data No data currently available.

No RNA-Seq data currently available for this Target.

Metabolomic Profiles No data currently available.

No Metabolomic data currently available for this Target.

Proteomic Data No data currently available.

No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology

BioCyc

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

Interactions based on ChIPSeq data

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1404 (-)

Interactions based on ChIPSeq data (Minch et al. 2014)

Binds To:
- No bindings to other targets were found.
Bound By:
- Rv1404 (-) (Direct binding)

Interactions based on TFOE data (Rustad et al. 2014)

Upregulates:
- Does not upregulate other genes.
Upregulated by:
- Not upregulated by other genes.
Downregulates:
- Does not downregulate other genes.
Downregulated by:
- Rv1404 (-)

TBCAP

Tubculosis Community Annotation Project (

Slayden et al., 2013

Rv1731 (gabD2)

Property	Value	Creator	Evidence	PMID	Comment
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Citation	Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005	njamshidi	IPI	16027371\|16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Citation	Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Citation	Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005	njamshidi	ISS	16027371\|16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Citation	Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
Citation	Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005	njamshidi	ISS	16027371\|16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Citation	Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Citation	Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005	njamshidi	IPI	16027371\|16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Citation	Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Citation	Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005	njamshidi	IPI	16027371\|16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - IPI	njamshidi	IPI	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Citation	Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Citation	Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Citation	Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005	njamshidi	ISS	16027371\|16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - ISS	njamshidi	ISS	16045627	this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371 J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005
Interaction	RegulatedBy Rv2069	yamir.moreno	TAS		Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase. - NR	extern:JZUCKER	NR		Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Other	EC:1.2.1.79	extern:JZUCKER			Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011
Citation	Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005	extern:JZUCKER		16045627	Inferred from mutant phenotype
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - NR	extern:JZUCKER	NR		Inferred from mutant phenotype J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Term	EC:1.2.1.24 Succinate-semialdehyde dehydrogenase. - NR	extern:JZUCKER	NR		Inferred from mutant phenotype J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Other	EC:1.2.1.79	extern:JZUCKER			Inferred from mutant phenotype J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005
Citation	Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Trends Microbiol. 2011	extern:JZUCKER		21561773	Traceable author statement to experimental support
Term	EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - NR	extern:JZUCKER	NR		Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011

Property

Value

Creator

Evidence

PMID

Comment

Term

EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI

njamshidi

IPI

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005

Term

TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI

njamshidi

IPI

16045627

Citation

Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005

njamshidi

IPI

16027371|16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371

Term

EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI

njamshidi

IPI

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Term

TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI

njamshidi

IPI

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Citation

Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005

njamshidi

ISS

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371

Term

EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS

njamshidi

ISS

16045627

Term

TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS

njamshidi

ISS

16045627

Citation

Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005

njamshidi

ISS

16027371|16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371

Term

EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS

njamshidi

ISS

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Term

TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS

njamshidi

ISS

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Citation

Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005

njamshidi

IPI

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371

Citation

Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005

njamshidi

ISS

16027371|16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371

Term

EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS

njamshidi

ISS

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Term

TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS

njamshidi

ISS

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Citation

Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005

njamshidi

IPI

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371

Term

EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI

njamshidi

IPI

16045627

Term

TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI

njamshidi

IPI

16045627

Citation

Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005

njamshidi

IPI

16027371|16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371

Term

EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - IPI

njamshidi

IPI

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Term

TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - IPI

njamshidi

IPI

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Term

TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - ISS

njamshidi

ISS

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371
J. Tian, R. Bryk et al. Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. Proc. Natl. Acad. Sci. U.S.A. 2005

Citation

Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005

njamshidi

IPI

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371

Term

EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - IPI

njamshidi

IPI

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371
J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005

Term

TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - IPI

njamshidi

IPI

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371
J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005

Citation

Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005

njamshidi

IPI

16027371|16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371

Term

EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - IPI

njamshidi

IPI

16045627

Term

TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - IPI

njamshidi

IPI

16045627

Citation

Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005

njamshidi

ISS

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) also PMID: 16027371

Term

EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - ISS

njamshidi

ISS

16045627

Term

TBRXN:SSALy succinate-semialdehyde dehydrogenase (NADP) - ISS

njamshidi

ISS

16045627

Citation

Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005

njamshidi

ISS

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371

Term

EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - ISS

njamshidi

ISS

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371
J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005

Term

TBRXN:SSALx succinate-semialdehyde dehydrogenase (NAD) - ISS

njamshidi

ISS

16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371
J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005

Citation

Variant tricarboxylic acid cycle in Mycobacterium tuberculosis: identification of alpha-ketoglutarate decarboxylase. J. Tian, R. Bryk et al. Proc. Natl. Acad. Sci. U.S.A. 2005

njamshidi

ISS

16027371|16045627

this is part of the pathway alternative to AKGDH (akg dehydrogenase whose activity has not been identified in tb - Tian et al unpublished data supports this see PMID: 16045627) PMID: 16027371

Term

EC:1.2.1.24 Succinate-semialdehyde dehydrogenase (NAD(+)). - ISS

njamshidi

ISS

16045627

Interaction

RegulatedBy Rv2069

yamir.moreno

TAS

Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support.
G. Balzsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008

Term

EC:1.2.1.24 Succinate-semialdehyde dehydrogenase. - NR

extern:JZUCKER

Traceable author statement to experimental support
authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011

Other

EC:1.2.1.79

extern:JZUCKER

Citation

Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. J. Tian, R. Bryk et al. Mol. Microbiol. 2005

extern:JZUCKER

16045627

Inferred from mutant phenotype

Term

EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - NR

extern:JZUCKER

Inferred from mutant phenotype
J. Tian, R. Bryk et al. Mycobacterium tuberculosis appears to lack alpha-ketoglutarate dehydrogenase and encodes pyruvate dehydrogenase in widely separated genes. Mol. Microbiol. 2005

Term

EC:1.2.1.24 Succinate-semialdehyde dehydrogenase. - NR

extern:JZUCKER

Other

EC:1.2.1.79

extern:JZUCKER

Citation

Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Trends Microbiol. 2011

extern:JZUCKER

21561773

Traceable author statement to experimental support

Term

EC:1.2.1.16 Succinate-semialdehyde dehydrogenase (NAD(P)(+)). - NR

extern:JZUCKER

Comments

TB Genome Annotation Portal

Rv1731 (gabD2)

Amino Acid Sequence

Additional Information

Analysis of Positive Selection in Clinical Isolates *new*

Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

Interactions based on ChIPSeq data

Interactions based on ChIPSeq data (Minch et al. 2014)

Interactions based on TFOE data (Rustad et al. 2014)

TBCAP

Comments

Analysis of Positive Selection in Clinical Isolates new