TB Genome Annotation Portal

Rv1663 (pks17)

Amino Acid Sequence

MEAGPQRIAQMLAELVELFKTEALHRLPVKSWDVRHAREAYRFLSQARHVGKVVLTMPDAWAAGTVLITGGTGMAGSAVARHLVSRYGVRQVVLASRAGE
HTESVAALVDELGSAGARVQVVSCDVADRDAVAGLVASQPDLTAVFHAAGVLDDAVITGLTPERVDKVLRAKVDGAWNLHELTRHLDVSAFVLFSSMAGI
VGAPGQANYAAANAFLDGLAAYRRSRGLAALSVAWGLWEQASAMTEHLGERDRVRMSRVGLAPLPTNQAMGFLDAALLADRPVVVAARLDRAALAGAELP
ALFSQLVAGPIRRIIDGADEVSGSGLASRLHGLTPEQRHRELTELVCSNAAIVLGHSGTEIDAHKAFQDLGFDSLTAVELRNRLKTATGLTLPPTLIFDY
PTAAELAEHLDIQLANAPAVTVDQPNPSTRFNEVTRELQALLDQPNWNPDDKTRLIKRLQAILTDCTAPPASSGPSTTHDDEDITTATESQLFAILDDEL
GP
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1663/pks17, gene len: 1508 bp, num TA sites: 19
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathessentialM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathuncertainM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.68)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.556)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, cofactors)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=0.73)YM rich vs minimal mediumresampling

Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NONO
omega peak height (95%CI lower bound)1.77 (0.56)1.4 (0.82)
codons under selection
omega plotsomega plot across ORF for Moldova isolatesomega plot across ORF for CRyPTIC isolates
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"



TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1663 (pks17)

    PropertyValueCreatorEvidencePMIDComment
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003njamshidiIDA12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    TermTBRXN:FASm2002 fatty acid synthase - methyl-arachidic acid - IDAnjamshidiIDA12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003njamshidiISS12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    TermTBRXN:FASm2002 fatty acid synthase - methyl-arachidic acid - ISSnjamshidiISS12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003njamshidiIDA12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    TermTBRXN:FASm2001 fatty acid synthase - tri-methyl behenic acid - IDAnjamshidiIDA12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003njamshidiISS12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    TermTBRXN:FASm2001 fatty acid synthase - tri-methyl behenic acid - ISSnjamshidiISS12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003njamshidiIDA12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    TermTBRXN:FASm1801 fatty acid synthase - dimethyl arachic acid - IDAnjamshidiIDA12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003njamshidiISS12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    TermTBRXN:FASm1801 fatty acid synthase - dimethyl arachic acid - ISSnjamshidiISS12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003njamshidiIDA12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    TermEC:2.3.1.85 Fatty-acid synthase. - IDAnjamshidiIDA12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    TermTBRXN:FASm180 fatty acid synthase - tuberculostearic acid - IDAnjamshidiIDA12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003njamshidiISS12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    TermEC:2.3.1.85 Fatty-acid synthase. - ISSnjamshidiISS12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    TermTBRXN:FASm180 fatty acid synthase - tuberculostearic acid - ISSnjamshidiISS12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003njamshidiIDA12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    TermTBRXN:FASm1601 fatty acid synthase - methyl octadecanoic acid - IDAnjamshidiIDA12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003njamshidiISS12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    TermTBRXN:FASm1601 fatty acid synthase - methyl octadecanoic acid - ISSnjamshidiISS12867474lumped rxns so no all are mono-methyl branches (some are multiple methyl group additions). pks8 and pks17 locus carries out branched methyl addition for C16-C20. PMID: 12867474
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv1664vashishtrvIEPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv1661vashishtrvIMPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv1662vashishtrvIMPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv1664shahanup86IEPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv1662shahanup86IMPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005vashishtrvIMP16199577Co-expression (Functional Linkage)
    InteractionPhysicalInteraction Rv1661vashishtrvIMPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionPhysicalInteraction Rv1662vashishtrvIMPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationSEARCHPKS: A program for detection and analysis of polyketide synthase domains. authors,G. Yadav,RS. Gokhale,D. Mohanty Nucleic Acids Res. 2003vashishtrvIMP12824387Co-expression (Functional Linkage)
    InteractionPhysicalInteraction Rv1661vashishtrvIMPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    InteractionPhysicalInteraction Rv1662vashishtrvIMPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003vashishtrvIMP12867474Co-expression (Functional Linkage)
    InteractionPhysicalInteraction Rv1662vashishtrvIEPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005shahanup86IMP16199577Co-expression (Functional Linkage)
    InteractionPhysicalInteraction Rv1661shahanup86IMPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionPhysicalInteraction Rv1662shahanup86IMPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationSEARCHPKS: A program for detection and analysis of polyketide synthase domains. authors,G. Yadav,RS. Gokhale,D. Mohanty Nucleic Acids Res. 2003shahanup86IMP12824387Co-expression (Functional Linkage)
    InteractionPhysicalInteraction Rv1661shahanup86IMPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    InteractionPhysicalInteraction Rv1662shahanup86IMPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    CitationBiochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. VS. Dubey, TD. Sirakova et al. J. Bacteriol. 2003shahanup86IMP12867474Co-expression (Functional Linkage)
    InteractionPhysicalInteraction Rv1661shahanup86IMPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv1662shahanup86IEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionPhysicalInteraction Rv1662shahanup86IEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    InteractionPhysicalInteraction Rv1662shahanup86IEPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv1662vashishtrvIEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionPhysicalInteraction Rv1662vashishtrvIEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    Symbolpks8-pks17mjacksonIMPPolymethyl-branched acyltrehaloses
    NameMas-like protein; synthesis of mono methyl branched C16 to C20 unsaturated acids [that are minor constituents of acyltrehaloses and sulfated acyltrehaloses]mjacksonIMPPolymethyl-branched acyltrehaloses

    Comments