TB Genome Annotation Portal

Rv1663 (pks17)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: polyketide synthase 17
  • REFSEQ: polyketide synthase pks17
  • PATRIC: Polyketide synthase Pks17
  • TUBERCULIST: Probable polyketide synthase Pks17
  • NCBI: Probable polyketide synthase Pks17
  • updated information (H37Rv4):
    • gene name: pks17
    • function:
    • reference:
• Type: Not Target
• Start: 1886512
• End: 1888020
• Operon:


• Trans-membrane region:
  
• Role: I.I - Polyketide and non-ribosomal peptide synthesis
• GO terms:
  • GO:0040007 - growth (Uniprot)
  • GO:0031177 - phosphopantetheine binding (Uniprot)
  • GO:0006636 - unsaturated fatty acid biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • H[c] + 2 NADPH[c] + SMMALONYLCOA[c] + HEXADECANOATE[c] -> NADP[c] + CO2[c] + COA[c] + METHYL_OCTADECANOATE[c]
  • 15 H[c] + 10 NADPH[c] + SMMALONYLCOA[c] + 4 MALCOA[c] + OCTANOATE[c] -> 10 NADP[c] + 5 CO2[c] + 5 COA[c] + TUBERCULOSTEROYL_ACP... <Preview truncated at 128 characters>
  • 3 H[c] + 2 NADPH[c] + SMMALONYLCOA[c] + METHYL_OCTADECANOATE[c] -> 2 NADP[c] + CO2[c] + COA[c] + DMARACH[c]
  • H[c] + 2 NADPH[c] + SMMALONYLCOA[c] + DMARACH[c] -> 2 NADP[c] + CO2[c] + COA[c] + TMBHN[c]
  • 3 H[c] + 2 NADPH[c] + SMMALONYLCOA[c] + OCTADECANOATE[c] -> 2 NADP[c] + CO2[c] + COA[c] + MARACH[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020):
  

  PDB	aa ident	species	PDB title
  3SLK	55%	Saccharopolyspora spinosa	Structure of ketoreductase and enoylreductase didomain from modular polyketide synthase
  6H0J	55%	Mycobacterium ulcerans (strain Agy99)	A1-type ACP domain from module 5 of MLSA1
  5HVC	52%	Mycobacterium ulcerans	Solution structure of the apo state of the acyl carrier protein from the MLSA2 subunit of the mycolactone polyketide synthase
  5HV8	52%	Mycobacterium ulcerans	Solution structure of an octanoyl- loaded acyl carrier protein domain from module MLSA2 of the mycolactone polyketide synthase.
  6H0Q	51%	Mycobacterium ulcerans (strain Agy99)	B1-type ACP domain from module 7 of MLSB
  2JU2	50%	Saccharopolyspora erythraea	Minimized mean solution structure of the acyl carrier protein domain from module 2 of 6-deoxyerythronolide B synthase (DEBS)
  2JU1	50%	Saccharopolyspora erythraea	Solution structure of acyl carrier protein domain from module 2 of 6-deoxyerythronolide B synthase (DEBS)
  5XWV	47%	Streptomyces nodosus	Substrate-bound Structure of a Ketoreductase from the Second Module of the amphotericin Polyketide Synthases
  3MJV	47%	Streptomyces nodosus	Structure of A-type Ketoreductases from Modular Polyketide Synthase
  3MJS	47%	Streptomyces nodosus	Structure of A-type Ketoreductases from Modular Polyketide Synthase

• Links to additional information on pks17:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.017 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

MEAGPQRIAQMLAELVELFKTEALHRLPVKSWDVRHAREAYRFLSQARHVGKVVLTMPDAWAAGTVLITGGTGMAGSAVARHLVSRYGVRQVVLASRAGE
HTESVAALVDELGSAGARVQVVSCDVADRDAVAGLVASQPDLTAVFHAAGVLDDAVITGLTPERVDKVLRAKVDGAWNLHELTRHLDVSAFVLFSSMAGI
VGAPGQANYAAANAFLDGLAAYRRSRGLAALSVAWGLWEQASAMTEHLGERDRVRMSRVGLAPLPTNQAMGFLDAALLADRPVVVAARLDRAALAGAELP
ALFSQLVAGPIRRIIDGADEVSGSGLASRLHGLTPEQRHRELTELVCSNAAIVLGHSGTEIDAHKAFQDLGFDSLTAVELRNRLKTATGLTLPPTLIFDY
PTAAELAEHLDIQLANAPAVTVDQPNPSTRFNEVTRELQALLDQPNWNPDDKTRLIKRLQAILTDCTAPPASSGPSTTHDDEDITTATESQLFAILDDEL
GP

Additional Information