TB Genome Annotation Portal

Rv1661 (pks7)

Amino Acid Sequence

MNSTPEDLVKALRRSLKQNERLKRENRDLLARTTEPVAVVGMGCRYPGGVDSPETLWELVAHGRDAVSEFPADRGWDVAGLFDPDPDAVGKSYTRCGGFL
TDVAGFDAEFFGIAPSEALAMDPQQRLLLEVSWEALERAGIDPITLRGSQTGVFAGVFHGSYGGQGRVPGDLERYGLRGSTLSVASGRVAYVLGLQGPAV
SVDTACSSSLVALHLAVQSLRLGECDLALVGGVTVMATPAMFIEFSRQRALSADGRCKAYAGAADGTAFAEGAGVLVLARLADARRLGHPVLALVRGSAV
NQDGASNGLATPNGPAQQRVITAALASARLGVADVDVVEGHGTGTTLGDPIEAQAILATYGQRPADRPLWLGSIKSNIGHTSAAAGVAGVIKMVQAMRHG
VLPKTLHVDVPTPHVDWSAGAVSLLTEPRPWHVPGRPRRAGVSSFGISGTNAHVILEEAPAVEPVGAAHGNDPVAVPWVLSARSAQALTNQARRLLAWVG
ADENVRPLDVGWSLVNTRSLFDHRAVVVGADRTQLMEGLTGLAAGVPGADVVAGRAQTVGKTAFVFPGQGAQWLGMGAQLCATAPVFAEHIHRCERALRE
HVEWSLLDVLRGAPGAPGLDRVDVVQPALWAVMVSLAELWRSVGVVPDAVIGHSQGEIAAAYVAGALSLRDAAAVVALRSRLLVRLGGAGGMVSLACGQP
QAEKLASQWGDRLNIAAVNGVSSVVLAGETDAVTELMQRCEAEGIRARRIDVDYASHSAQVDAIREELIAALRGIEPRTSTVAFFSTVTGELMDTAGVNA
EYWYRSIRQPVQFERAVRNAFDGGYRVFVESSPHPVLIAGIEETLVDCDRGATGEPIVIPTLGRDDGGVGRFWLSAGQAHVAGVGVDWRAAFADLGGRRV
ELPTYAFARQRFWLDGLGAVGGDLGGVGLVGAEHGLLAAVVQRPDSGGVVLTGRISVVAAPWLADHAVGPVVLFPGTGFVELALRAGDEVGCSVLQELTL
QAPLVLPADGVRVQVVVGGVEQSGTRNVWVYSAAGQADSSPGWTLHAQGVLGVGSVQPAAELSVWPPVGARAMDVADGYQVLAARGYGYGPAFRGLQALW
RRGAEVFADVTLPEGVPIRGFGIHPAVLDAALHAWGIVEGEQQTMLPFSWQGVCLHASGAARVRVRLAPVGRGAVSVELADPQGLPVLSVRQLMVRPVSA
AALSRSTAGDRGLLEMIWTPVPLEGGDIGDDAVVWELPPHAGAQAGGDVLAAVYRGVHEVLEVLQSWLASDATGLGVVVTRGAVGPVDDDVTDLAGAAVW
GLVRSAQAEHPGRVVLVDTDGSVAVEDAVGFGARSGEPQLVVRRGRVYAARLAPVAAGLTLPSASAGGWRLVAGGGGTLADVVVAPVAPVELATGQVRVA
VGAVGVNFRDVLVALGMYPGGGELGVDGAGVVVEVGPGVTGLAVGDRVMGLLGLVGSEAVVDARLVTMVPAGWSLVEAAAVPVAFLTAFYGLSVLAEVAA
GQKVLVHAGTGGVGMAAVSLARYWGAEVFVTASRAKWDTLRAMGFDDIHISDSRSLEFEEAFLRATEGSGVDVVLNSLAGEFTDASLRLLPSGGRFIELG
KTDIRDGQTVAERHRGVRYRAFDLVEAGPDRIAAMLSEVVGLLAAGVLARLPVKTFDARCAPAAYRFVSQARHIGKVVLTIPDGPGGQSGLAGGTVVVTG
GTGMAGSAVATHLVRRHGVANLVLVSRSGEQADRAAEVAALLREGGAQVAVVSCDVADRDALAALLAGLDPRYPLKGVFHAAGVLDDAVITGLTPDRVDT
VLRAKVDGAWNLHELTEDMDLSAFVVFSSMAGIVGTPAQGNYAAANAFLDGLVAYRRSRGLAGLSVAWGLWEQASAMTRHLGERDRARMTQAGLAPLTTE
QALGFLDTALQADRAVVVAARLDRAALAGAGAALPALFSQLAAGPTRRRIDAADTAVSMSGLVSRLHALTPERRQRELTDLVISNAAAVLGRSSSVDINA
HKAFQDLGFDSLTAVELRNRLKTATGLTLSPTLIFDYPTPATLAEHLDSRLVTASGSDQQSLSDRVDDITRELVVLLDQPDLSANVKAHLRTRLQTMLTS
LTTEDDDIAAATESQLFAILDEELGS
(Nucleotide sequence available on KEGG)

Additional Information




Analysis of Positive Selection in Clinical Isolates *new*

Moldova (2,057)global set (5,195)
under significant positive selection?NOYES
omega peak height (95%CI lower bound)2.37 (0.88)1.74 (1.03)
codons under selection414, 415, 416, 417, 418, 419, 420, 421, 422
omega plots
genetic variants*linklink
statistics at each codonlinklink
* example format for variants: "D27 (GAC): D27H (CAC,11)" means "Asp27 (native codon GAC) mutated to His (codon CAC) in 11 isolates"


ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across ~100 conditions

Rv1661/pks7, gene len: 6380 bp, num TA sites: 82
conditiondatasetcallmediummethodnotes
in-vitroDeJesus 2017 mBionon-essential7H9HMMfully saturated, 14 TnSeq libraries combined
in-vitroSassetti 2003 Mol Microessential 7H9TRASHessential if hybridization ratio<0.2
in-vivo (mice)Sassetti 2003 PNASnon-essential BL6 miceTRASHessential if hybridization ratio<0.4, min over 4 timepoints (1-8 weeks)
in-vitro (glycerol)Griffin 2011 PPathuncertainM9 minimal+glycerolGumbel2 replicates; Padj<0.05
in-vitro (cholesterol)Griffin 2011 PPathuncertainM9 minimal+cholesterolGumbel3 replicates; Padj<0.05
differentially essential in cholesterol Griffin 2011 PPathNO (LFC=-0.01)cholesterol vs glycerolresampling-SRYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in cholesterol
in-vitroSmith 2022 eLifenon-essential7H9HMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
in-vivo (mice)Smith 2022 eLifenon-essentialBL6 miceHMM6 replicates (raw data in Subramaniam 2017, PMID 31752678)
differentially essential in miceSmith 2022 eLifeNO (LFC=0.212)in-vivo vs in-vitroZINBYES if Padj<0.05, else not significant; LFC<0 means less insertions/more essential in mice
in-vitro (minimal)Minato 2019 mSysnon-essentialminimal mediumHMM
in-vitro (YM rich medium)Minato 2019 mSysnon-essentialYM rich mediumHMM7H9 supplemented with ~20 metabolites (amino acids, vitamins)
differentially essential in YM rich mediumMinato 2019 mSysNO (LFC=-1.16)YM rich vs minimal mediumresampling

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1661 (pks7)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv1663vashishtrvIMPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv1663shahanup86IMPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv1663vashishtrvIMPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionPhysicalInteraction Rv1663vashishtrvIMPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    InteractionPhysicalInteraction Rv1663shahanup86IMPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionPhysicalInteraction Rv1663shahanup86IMPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005shahanup86IEP16199577Co-expression (Functional Linkage)
    InteractionRegulatory Rv0735shahanup86IEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationSEARCHPKS: A program for detection and analysis of polyketide synthase domains. authors,G. Yadav,RS. Gokhale,D. Mohanty Nucleic Acids Res. 2003shahanup86IEP12824387Co-expression (Functional Linkage)
    InteractionRegulatory Rv0735shahanup86IEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005vashishtrvIEP16199577Co-expression (Functional Linkage)
    InteractionRegulatory Rv0735vashishtrvIEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationSEARCHPKS: A program for detection and analysis of polyketide synthase domains. authors,G. Yadav,RS. Gokhale,D. Mohanty Nucleic Acids Res. 2003vashishtrvIEP12824387Co-expression (Functional Linkage)
    InteractionRegulatory Rv0735vashishtrvIEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005shahanup86IEP16199577Co-expression (Functional Linkage)
    InteractionOperon Rv1660shahanup86IEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationSEARCHPKS: A program for detection and analysis of polyketide synthase domains. authors,G. Yadav,RS. Gokhale,D. Mohanty Nucleic Acids Res. 2003shahanup86IEP12824387Co-expression (Functional Linkage)
    InteractionOperon Rv1660shahanup86IEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005vashishtrvIEP16199577Co-expression (Functional Linkage)
    InteractionOperon Rv1660vashishtrvIEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationSEARCHPKS: A program for detection and analysis of polyketide synthase domains. authors,G. Yadav,RS. Gokhale,D. Mohanty Nucleic Acids Res. 2003vashishtrvIEP12824387Co-expression (Functional Linkage)
    InteractionOperon Rv1660vashishtrvIEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    InteractionOperon Rv1660harsharohiratruefriendNASoperon
    TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
    CitationRole of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. P. Constant, E. Perez et al. J. Biol. Chem. 2002jjmcfadden12138124Inferred from direct assay
    OtherEC:jjmcfaddenInferred from direct assay
    P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002

    Comments