TB Genome Annotation Portal

Rv1661 (pks7)

Amino Acid Sequence

MNSTPEDLVKALRRSLKQNERLKRENRDLLARTTEPVAVVGMGCRYPGGVDSPETLWELVAHGRDAVSEFPADRGWDVAGLFDPDPDAVGKSYTRCGGFL
TDVAGFDAEFFGIAPSEALAMDPQQRLLLEVSWEALERAGIDPITLRGSQTGVFAGVFHGSYGGQGRVPGDLERYGLRGSTLSVASGRVAYVLGLQGPAV
SVDTACSSSLVALHLAVQSLRLGECDLALVGGVTVMATPAMFIEFSRQRALSADGRCKAYAGAADGTAFAEGAGVLVLARLADARRLGHPVLALVRGSAV
NQDGASNGLATPNGPAQQRVITAALASARLGVADVDVVEGHGTGTTLGDPIEAQAILATYGQRPADRPLWLGSIKSNIGHTSAAAGVAGVIKMVQAMRHG
VLPKTLHVDVPTPHVDWSAGAVSLLTEPRPWHVPGRPRRAGVSSFGISGTNAHVILEEAPAVEPVGAAHGNDPVAVPWVLSARSAQALTNQARRLLAWVG
ADENVRPLDVGWSLVNTRSLFDHRAVVVGADRTQLMEGLTGLAAGVPGADVVAGRAQTVGKTAFVFPGQGAQWLGMGAQLCATAPVFAEHIHRCERALRE
HVEWSLLDVLRGAPGAPGLDRVDVVQPALWAVMVSLAELWRSVGVVPDAVIGHSQGEIAAAYVAGALSLRDAAAVVALRSRLLVRLGGAGGMVSLACGQP
QAEKLASQWGDRLNIAAVNGVSSVVLAGETDAVTELMQRCEAEGIRARRIDVDYASHSAQVDAIREELIAALRGIEPRTSTVAFFSTVTGELMDTAGVNA
EYWYRSIRQPVQFERAVRNAFDGGYRVFVESSPHPVLIAGIEETLVDCDRGATGEPIVIPTLGRDDGGVGRFWLSAGQAHVAGVGVDWRAAFADLGGRRV
ELPTYAFARQRFWLDGLGAVGGDLGGVGLVGAEHGLLAAVVQRPDSGGVVLTGRISVVAAPWLADHAVGPVVLFPGTGFVELALRAGDEVGCSVLQELTL
QAPLVLPADGVRVQVVVGGVEQSGTRNVWVYSAAGQADSSPGWTLHAQGVLGVGSVQPAAELSVWPPVGARAMDVADGYQVLAARGYGYGPAFRGLQALW
RRGAEVFADVTLPEGVPIRGFGIHPAVLDAALHAWGIVEGEQQTMLPFSWQGVCLHASGAARVRVRLAPVGRGAVSVELADPQGLPVLSVRQLMVRPVSA
AALSRSTAGDRGLLEMIWTPVPLEGGDIGDDAVVWELPPHAGAQAGGDVLAAVYRGVHEVLEVLQSWLASDATGLGVVVTRGAVGPVDDDVTDLAGAAVW
GLVRSAQAEHPGRVVLVDTDGSVAVEDAVGFGARSGEPQLVVRRGRVYAARLAPVAAGLTLPSASAGGWRLVAGGGGTLADVVVAPVAPVELATGQVRVA
VGAVGVNFRDVLVALGMYPGGGELGVDGAGVVVEVGPGVTGLAVGDRVMGLLGLVGSEAVVDARLVTMVPAGWSLVEAAAVPVAFLTAFYGLSVLAEVAA
GQKVLVHAGTGGVGMAAVSLARYWGAEVFVTASRAKWDTLRAMGFDDIHISDSRSLEFEEAFLRATEGSGVDVVLNSLAGEFTDASLRLLPSGGRFIELG
KTDIRDGQTVAERHRGVRYRAFDLVEAGPDRIAAMLSEVVGLLAAGVLARLPVKTFDARCAPAAYRFVSQARHIGKVVLTIPDGPGGQSGLAGGTVVVTG
GTGMAGSAVATHLVRRHGVANLVLVSRSGEQADRAAEVAALLREGGAQVAVVSCDVADRDALAALLAGLDPRYPLKGVFHAAGVLDDAVITGLTPDRVDT
VLRAKVDGAWNLHELTEDMDLSAFVVFSSMAGIVGTPAQGNYAAANAFLDGLVAYRRSRGLAGLSVAWGLWEQASAMTRHLGERDRARMTQAGLAPLTTE
QALGFLDTALQADRAVVVAARLDRAALAGAGAALPALFSQLAAGPTRRRIDAADTAVSMSGLVSRLHALTPERRQRELTDLVISNAAAVLGRSSSVDINA
HKAFQDLGFDSLTAVELRNRLKTATGLTLSPTLIFDYPTPATLAEHLDSRLVTASGSDQQSLSDRVDDITRELVVLLDQPDLSANVKAHLRTRLQTMLTS
LTTEDDDIAAATESQLFAILDEELGS
(Nucleotide sequence available on KEGG)

Additional Information



ESSENTIALITY

MtbTnDB - interactive tool for exploring a database of published TnSeq datasets for Mtb

TnSeqCorr - genes with correlated TnSeq profiles across >100 conditions *new*

Classification Condition Strain Method Reference Notes
Essential Sodium Oleate H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 0.998700;
19 non-insertions in a row out of 81 sites
Essential Lignoceric Acid H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
18 non-insertions in a row out of 81 sites
Essential Phosphatidylcholine H37RvMA Gumbel Subhalaxmi Nambi Probability of Essentiality: 1.000000;
19 non-insertions in a row out of 81 sites
Uncertain minimal media + 0.1% glycerol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.980250;
12 non-insertions in a row out of 82 sites
Essential minimal media + 0.01% cholesterol H37RvMA Gumbel Griffin et al. (2011) Probability of Essentiality: 0.996800;
14 non-insertions in a row out of 82 sites
Essential 7H10-glycerol H37RvMA TraSH Sassetti et al. (2003a)
Essential C57BL/6J mice (8 weeks) H37RvMA TraSH Sassetti et al. (2003b) Hybridization Ratio: 0.08
Non-Essential 7H09/7H10 + rich media H37RvMA MotifHMM DeJesus et al. (2017) Fully saturated (14 reps).

TnSeq Data No data currently available.
  • No TnSeq data currently available for this Target.
RNASeq Data No data currently available.
  • No RNA-Seq data currently available for this Target.
Metabolomic Profiles No data currently available.
  • No Metabolomic data currently available for this Target.
Proteomic Data No data currently available.
  • No Proteomic data currently available for this Target.

Regulatory Relationships from Systems Biology
  • BioCyc

    Gene interactions based on ChIPSeq and Transcription Factor Over-Expression (TFOE) (Systems Biology)

    NOTE: Green edges represent the connected genes being classified as differentially essential as a result of the middle gene being knocked out. These interactions are inferred based on RNASeq.

    Interactions based on ChIPSeq data

  • Interactions based on ChIPSeq data (Minch et al. 2014)

    • Binds To:

      • No bindings to other targets were found.
    • Bound By:

      • No bindings to other targets were found.

    Interactions based on TFOE data (Rustad et al. 2014)



    TBCAP

    Tubculosis Community Annotation Project (
    Slayden et al., 2013)

    Rv1661 (pks7)

    PropertyValueCreatorEvidencePMIDComment
    InteractionPhysicalInteraction Rv1663vashishtrvIMPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv1663shahanup86IMPCo-expression (Functional Linkage)
    VS. Dubey, TD. Sirakova et al. Biochemical function of msl5 (pks8 plus pks17) in Mycobacterium tuberculosis H37Rv: biosynthesis of monomethyl branched unsaturated fatty acids. J. Bacteriol. 2003
    InteractionPhysicalInteraction Rv1663vashishtrvIMPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionPhysicalInteraction Rv1663vashishtrvIMPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    InteractionPhysicalInteraction Rv1663shahanup86IMPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    InteractionPhysicalInteraction Rv1663shahanup86IMPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005shahanup86IEP16199577Co-expression (Functional Linkage)
    InteractionRegulatory Rv0735shahanup86IEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationSEARCHPKS: A program for detection and analysis of polyketide synthase domains. authors,G. Yadav,RS. Gokhale,D. Mohanty Nucleic Acids Res. 2003shahanup86IEP12824387Co-expression (Functional Linkage)
    InteractionRegulatory Rv0735shahanup86IEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005vashishtrvIEP16199577Co-expression (Functional Linkage)
    InteractionRegulatory Rv0735vashishtrvIEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationSEARCHPKS: A program for detection and analysis of polyketide synthase domains. authors,G. Yadav,RS. Gokhale,D. Mohanty Nucleic Acids Res. 2003vashishtrvIEP12824387Co-expression (Functional Linkage)
    InteractionRegulatory Rv0735vashishtrvIEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005shahanup86IEP16199577Co-expression (Functional Linkage)
    InteractionOperon Rv1660shahanup86IEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationSEARCHPKS: A program for detection and analysis of polyketide synthase domains. authors,G. Yadav,RS. Gokhale,D. Mohanty Nucleic Acids Res. 2003shahanup86IEP12824387Co-expression (Functional Linkage)
    InteractionOperon Rv1660shahanup86IEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    CitationThe Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. MY. Hahn, S. Raman et al. J. Bacteriol. 2005vashishtrvIEP16199577Co-expression (Functional Linkage)
    InteractionOperon Rv1660vashishtrvIEPCo-expression (Functional Linkage)
    MY. Hahn, S. Raman et al. The Mycobacterium tuberculosis extracytoplasmic-function sigma factor SigL regulates polyketide synthases and secreted or membrane proteins and is required for virulence. J. Bacteriol. 2005
    CitationSEARCHPKS: A program for detection and analysis of polyketide synthase domains. authors,G. Yadav,RS. Gokhale,D. Mohanty Nucleic Acids Res. 2003vashishtrvIEP12824387Co-expression (Functional Linkage)
    InteractionOperon Rv1660vashishtrvIEPCo-expression (Functional Linkage)
    authors,G. Yadav,RS. Gokhale,D. Mohanty SEARCHPKS: A program for detection and analysis of polyketide synthase domains. Nucleic Acids Res. 2003
    InteractionOperon Rv1660harsharohiratruefriendNASoperon
    TD. Sirakova, VS. Dubey et al. Attenuation of Mycobacterium tuberculosis by disruption of a mas-like gene or a chalcone synthase-like gene, which causes deficiency in dimycocerosyl phthiocerol synthesis. J. Bacteriol. 2003
    CitationRole of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. P. Constant, E. Perez et al. J. Biol. Chem. 2002jjmcfadden12138124Inferred from direct assay
    OtherEC:jjmcfaddenInferred from direct assay
    P. Constant, E. Perez et al. Role of the pks15/1 gene in the biosynthesis of phenolglycolipids in the Mycobacterium tuberculosis complex. Evidence that all strains synthesize glycosylated p-hydroxybenzoic methyl esters and that strains devoid of phenolglycolipids harbor a frameshift mutation in the pks15/1 gene. J. Biol. Chem. 2002

    Comments