TB Genome Annotation Portal

Rv1647 (-)

• Current annotations:
  • TBCAP: (community-based annotations - see table at bottom of page)
  • TBDB: adenylate cyclase
  • REFSEQ: hypothetical protein
  • PATRIC: Purine cyclase-related protein
  • TUBERCULIST: Adenylate cyclase (ATP pyrophosphate-lyase) (adenylyl cyclase)
  • NCBI: Adenylate cyclase (ATP pyrophosphate-lyase) (adenylyl cyclase)
  • updated information (H37Rv4):
    • gene name: -
    • function:
    • reference:
• Type: Not Target
• Start: 1856774
• End: 1857724
• Operon:


• Trans-membrane region:
  
• Role: V - Conserved hypotheticals
• GO terms:
  • GO:0042803 - protein homodimerization activity (Uniprot)
  • GO:0035556 - intracellular signal transduction (Uniprot)
  • GO:0030145 - manganese ion binding (Uniprot)
  • GO:0016849 - phosphorus-oxygen lyase activity (Uniprot)
  • GO:0016829 - lyase activity (Uniprot)
  • GO:0009190 - cyclic nucleotide biosynthetic process (Uniprot)
  • GO:0007165 - signal transduction (Uniprot)
  • GO:0006171 - cAMP biosynthetic process (Uniprot)
  • GO:0005886 - plasma membrane (Uniprot)
  • GO:0005622 - intracellular (Uniprot)
  • GO:0004016 - adenylate cyclase activity (Uniprot)
  • GO:0000287 - magnesium ion binding (Uniprot)
• Reaction(s) (based on iSM810 metabolic model):
  • ATP[c] -> PPI[c] + cAMP[c]
• Gene Expression Profile (Transcriptional Responses to Drugs; Boshoff et al, 2004)
• Gene Modules extracted from cluster analysis of 249 transcriptomic datasets using ICA
• Orthologs among selected mycobacteria
• Protein structure:
• Search for Homologs in PDB
• Top 10 Homologs in PDB (as of Nov 2020): (none with >35% aa id)
• Links to additional information on Rv1647:
  • TBDB (updated)
  • Phyre2 structure prediction, model: final.casp.pdb (from Mao et al, 2013)
  • UniProt
  • AlphaFold model
  • Vulnerability = 1.013 (from Jeremy Rock's lab)
  • KEGG - nucleotide and amino acid sequences of gene
  • Mycobrowser
  • PATRIC
  • BioCyc
  • Systems Biology

Amino Acid Sequence

LAGSARTTYPCHVEVGPQDSESGAPDETATAMASPVPRQRSALRWLRTVNRSPGLVSFIHRARRLLPGDPEFGDPLSTAGEGGPRAAARAADRLLRDRDA
ASREVGLSVLQVWQALTEAVSRRPANPEVTLVFTDLVGFSTWSLHAGDDATLTLLRQVARAVESPLLDAGGHIVKRLGDGIMAVFRNPTVALRAVLVAQD
AVKSLEVQGYTPRMRIGIHTGRPQRLAADWLGVDVNIAARVMERATKGGIMISQPTLDLIPQSELDALGVVARRVRKPVFASKPTGIPPDLAIYRIKTVS
ESTAADNFDEMSPDAQ

Additional Information